Report for 1889.m00206

 > 1889.m00206, length: 556, copies: 1 

MLRPFPATAHHRCTLLLLLTVTLLPSLAAAAAAHHHHLHDHAAGDGVVISQADYQGLQAIKHDLTDPYAFLRSWN

DTGLGACSGAWVGIKCVQGKVVAITLPWRGLAGTLSERIGQLTQLRRLSLHDNAISGPIPTSLGFLPDLRGVYLF

NNRFSGAVPASIGNCVALQAFDASNNLLTGAIPPSLANSTKLMRLNLSHNTISGDIPSELAASPSLVFLSLSHNK

LSGHIPDTFAGSRAPSSSSLKESITGTYNLAVLELSHNSLDGQIPDSLAGLQKLQVMDLSGNRLNGTIPDRLGSL

ADLKTLDLSGNALTGEIPASLSNLTTTLQAFNVSNNNLFGQVPLLLAQKFRPSLFAGNIQLCGYFVSVPCPELPS

SGPIAPASPKRSESGGKQPTSSKAAGGGAGGAAGGGRGEKPGSGXAKVESGGEVGGKLVHFDGPMAFTADDLLCA

TAEIMGKSTYGTVYKATLEDGSLVAVKRLREKITKGHKDFESEAAVLGKIRHPNLLPLRAYYLGPKGEKLLVLDF

MPNGSLSQFLHGQYSLTHYSSSCAFDLDTIN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	119	142	0.027
LRR [Pfam ls]	167	190	5.4
LRR [Pfam ls]	191	214	0.29
LRR [Pfam ls]	215	238	0.019
LRR [Pfam ls]	254	277	0.032
LRR [Pfam ls]	278	301	0.07
LRR [Pfam fs]	302	325	4.8e-05
LRR [Pfam ls]	302	325	0.00081
Ser/Thr pkinase [Pfam fs]	459	542	1.9e-13

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	119	142	0.0012
LRR [sensitive, ls]	119	142	0.027
LRR [sensitive, ls]	143	166	1.1
LRR [sensitive, ls]	143	166	25
LRR [sensitive, ls]	167	190	0.24
LRR [sensitive, ls]	167	190	5.4
LRR [sensitive, ls]	191	214	0.013
LRR [sensitive, ls]	191	214	0.29
LRR [sensitive, ls]	215	238	0.00085
LRR [sensitive, ls]	215	238	0.019
LRR [sensitive, ls]	254	277	0.0014
LRR [sensitive, ls]	254	277	0.032
LRR [sensitive, ls]	278	301	0.0031
LRR [sensitive, ls]	278	301	0.07
LRR [sensitive, ls]	302	325	3.6e-05
LRR [sensitive, ls]	302	325	0.00081
LRR [sensitive, ls]	327	351	1.6
LRR [sensitive, ls]	327	351	35

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	14	343	1e-35
CLV2 [A. thaliana]	47	298	5e-11
FLS2 [A.thaliana]	51	343	4e-35
CLV2 [A. thaliana]	77	363	1e-26
Xa21 [O. sativa]	79	375	1e-36
Cf-9 [L. pimpinellifolium]	91	347	1e-26
FLS2 [A.thaliana]	91	343	2e-32
CLV2 [A. thaliana]	95	345	2e-31
FLS2 [A.thaliana]	96	346	3e-26
Cf-9 [L. pimpinellifolium]	98	343	5e-11
CLV2 [A. thaliana]	98	362	1e-23
Cf-9 [L. pimpinellifolium]	99	343	5e-27
Xa21 [O. sativa]	99	344	2e-29
Cf-9 [L. pimpinellifolium]	106	361	7e-23
Cf-9 [L. pimpinellifolium]	106	342	2e-22
Cf-9 [L. pimpinellifolium]	106	318	3e-17
FLS2 [A.thaliana]	106	537	4e-48
FLS2 [A.thaliana]	106	343	4e-34
CLV2 [A. thaliana]	108	342	2e-29
FLS2 [A.thaliana]	108	343	3e-26
Cf-9 [L. pimpinellifolium]	117	370	4e-21
Cf-9 [L. pimpinellifolium]	147	246	9e-13
Xa21 [O. sativa]	255	356	1e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	13	35	in -> out

Report for 1889.m00206

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)