Report for 1972.m00164

 > 1972.m00164, length: 539, copies: 1 

MAGRAALLALLLALAAPAPAASQPAAVDPPPSWAFPNARLRAAYVALQAWRRTAIFSDPANFTANWSGPDVCGYN

GVFCAAHPTDGRVRVVAGLDLNHADIAGYIPASLPEGLPDLALLHLNSNRFCGVLPDTFSHLRLLHELDISNNRF

VGGFPEVVLSLPSLRYLDLRFNDFEGAIPPKLFDRPLDAIFLNSNRLTRPIPPNLGSSPASVVVLAHNRLGGCIP

PSIGRMAETLNEIVLIDDELTGCIPPQVGLLRKVTVFDVSGNHLQGPLPGSVAGLAAVEQLDVAGNLFEGPVPAT

ICSLQSLKNFTYEDNFFSSRPGCPAATADGRWNCIPGAPAQRPPAQCAAAAAHPFDCSKAQCQATPPTTRRPGGR

TPLAPHRSPLPHHMPPRRTPPTPPPPSSPTPFHLPPPPPTYSESPKSSMPPSTSPPSSHGASPPSSSSSPPTEHP

GYVLPPLTPPPPTTTPPGHHAPGPGNTILAGQALLGRHLKEAEGKLPFPPVHGVAYSSPPPPPSGDKLPFPPVYG

VAYSSPPPPSKPYN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	115	138	0.96
LRR [Pfam ls]	139	162	2.8
LRR [Pfam ls]	163	187	0.1
LRR [Pfam ls]	258	281	4.3

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	90	114	2.3
LRR [sensitive, ls]	90	114	53
LRR [sensitive, ls]	115	138	0.041
LRR [sensitive, ls]	115	138	0.96
LRR [sensitive, ls]	139	162	0.12
LRR [sensitive, ls]	139	162	2.8
LRR [sensitive, ls]	163	187	0.0044
LRR [sensitive, ls]	163	187	0.1
LRR [sensitive, ls]	258	281	0.19
LRR [sensitive, ls]	258	281	4.3
LRR [sensitive, ls]	282	305	0.92
LRR [sensitive, ls]	282	305	21

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	52	321	2e-19
CLV2 [A. thaliana]	64	318	7e-16
FLS2 [A.thaliana]	73	318	1e-17
Xa21 [O. sativa]	75	317	2e-16
FLS2 [A.thaliana]	83	315	4e-20
Xa21 [O. sativa]	83	294	2e-13
FLS2 [A.thaliana]	88	298	6e-17
FLS2 [A.thaliana]	90	318	2e-16
Xa21 [O. sativa]	91	317	2e-19
Cf-9 [L. pimpinellifolium]	94	315	2e-14
Cf-9 [L. pimpinellifolium]	94	318	8e-11
CLV2 [A. thaliana]	94	318	5e-19
CLV2 [A. thaliana]	94	322	1e-12
CLV2 [A. thaliana]	94	298	2e-11
FLS2 [A.thaliana]	94	320	4e-16
FLS2 [A.thaliana]	97	308	5e-17
CLV2 [A. thaliana]	116	318	1e-18
CLV2 [A. thaliana]	116	318	7e-16
Xa21 [O. sativa]	119	318	3e-19

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 1972.m00164

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)