Report for 1978.m00149

 > 1978.m00149, length: 1143, copies: 2 

MSSRVVVVSGVLVLVLVVVSVCGRAAACVEAEREALLSFLAAAAPPAGDGIAAQWRGSPDCCAWDGVGCGVDGAV

TRLWLPGRGLGGTISPSIANLTALTYLNLSGNSLSGRFPDLLFALPNATVVDVSYNRLSGELPNAPVAAAAATNA

RGSLSLQVLDVSSNLLAGRFPSAIWEHTPRLVSLNASNNSFHGSIPSLCASCPALAVLDLSVNVLSGAISPGFSN

CSWLRVLSVGRNNLTGELPGDIFDVKPLQRLQLPSNQIEGRLDPERIAKLTNLITLDLTYNMFTGELPESISQLT

KLEELRLGHNDFTGTLPPALSNWTSLRCLDLRSNSFVGDLTVVDFSGLANLTVFDVAANNFTGTIPPSIYSCTAM

KALRVSNNLMVGQISPEIGNLKELQFFSLTVNSFVNISGMFWNLKGCTSLTALLVSYNFYGEALPDAGWVGDHVR

SVRLMVMQNCALTGVIPSWLSKLQDLNVLDLSGNRLTGPIPSWLGAMPKLYYVDLSGNQLSGVIPPSLMEMRLLT

SEQAMAELYPGHLPLMFTLTPNNGAASRQGRGYFQMSGVATTLNFSDNGITGAIPPEIVKLKTLQVLDVSYNNLS

GGIPPELSSLTRLQIVNLRWNRLTGTIPQALKELNFLAVFNVAYNDLEGPIPTGGQFDAFPPRDFTGNPKLCGEV

ISVPCGDRFDATDTTSSKVVGKKALVAIVLGVCVGLVALVVFLGCVVIAFRRVVSNGAVRDGGKCVESTLFDSMS

EMYGDSSKDTILFMSEAAGEAASGVTFVDILKATNNFSAGNIIGSGGYGLVFLAELQDGTRLAVKKLNGDMCLVE

REFQAEVEALSATRHQNLVPLLGFCIRGRLRLLNYPYMANGSLHDWLHERRAGAGRGAPQRLDWRARLRIARGVL

YIHDQCKPQIVHRDIKSSNILLDEAGEARVADFGLARLILPDRTHVTTELVGTLGYIPPEYGQALAATLRGDVYS

FGVVLLELLTGRRPVEALPHGQQRELVRWVLQMRSQGRHGEVLDQRLRGKGDEAQMLAADGDEDGTNDGHRRVMR

RTAAGDERGQWRATEPDNGFGVMGAEKEWEGVRRGLCFLYVNMSAAAVTGGGEGAGSGGVTEGDGSRSINTNEGS

TASPSNEEPFSRLKYAEL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	98	121	0.04
LRR [Pfam ls]	155	179	1.9
LRR [Pfam ls]	180	203	2
LRR [Pfam ls]	204	227	4.7
LRR [Pfam ls]	277	300	0.058
LRR [Pfam ls]	301	324	0.004
LRR [Pfam ls]	325	349	6.5
LRR [Pfam ls]	350	373	5
LRR [Pfam ls]	475	498	0.008
LRR [Pfam ls]	499	522	0.18
LRR [Pfam fs]	588	611	3.2e-05
LRR [Pfam ls]	588	611	0.00052
LRR [Pfam ls]	612	635	0.65
Ser/Thr pkinase [Pfam fs]	787	989	1.9e-46
Ser/Thr pkinase [Pfam ls]	787	1091	2.4e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	74	97	3.9
LRR [sensitive, ls]	74	97	90
LRR [sensitive, ls]	98	121	0.0017
LRR [sensitive, ls]	98	121	0.04
LRR [sensitive, ls]	122	146	2.3
LRR [sensitive, ls]	122	146	53
LRR [sensitive, ls]	155	179	0.082
LRR [sensitive, ls]	155	179	1.9
LRR [sensitive, ls]	180	203	0.084
LRR [sensitive, ls]	180	203	2
LRR [sensitive, ls]	204	227	0.2
LRR [sensitive, ls]	204	227	4.7
LRR [sensitive, ls]	228	251	3.4
LRR [sensitive, ls]	228	251	80
LRR [sensitive, ls]	252	276	0.73
LRR [sensitive, ls]	252	276	17
LRR [sensitive, ls]	277	300	0.0025
LRR [sensitive, ls]	277	300	0.058
LRR [sensitive, ls]	301	324	0.00017
LRR [sensitive, ls]	301	324	0.004
LRR [sensitive, ls]	325	349	0.28
LRR [sensitive, ls]	325	349	6.5
LRR [sensitive, ls]	350	373	0.21
LRR [sensitive, ls]	350	373	5
LRR [sensitive, ls]	374	397	1.2
LRR [sensitive, ls]	374	397	28
LRR [sensitive, ls]	398	420	1.9
LRR [sensitive, ls]	398	420	45
LRR [sensitive, ls]	451	474	0.37
LRR [sensitive, ls]	451	474	8.6
LRR [sensitive, ls]	475	498	0.00034
LRR [sensitive, ls]	475	498	0.008
LRR [sensitive, ls]	499	522	0.0077
LRR [sensitive, ls]	499	522	0.18
LRR [sensitive, ls]	564	587	0.35
LRR [sensitive, ls]	564	587	8.1
LRR [sensitive, ls]	588	611	2.2e-05
LRR [sensitive, ls]	588	611	0.00052
LRR [sensitive, ls]	612	635	0.028
LRR [sensitive, ls]	612	635	0.65
LRR [sensitive, ls]	636	669	3.8
LRR [sensitive, ls]	636	669	88

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	30	652	5e-61
Xa21 [O. sativa]	35	873	4e-71
Cf-9 [L. pimpinellifolium]	55	652	6e-35
CLV2 [A. thaliana]	55	680	6e-51
Cf-9 [L. pimpinellifolium]	75	317	2e-16
Cf-9 [L. pimpinellifolium]	77	515	9e-29
FLS2 [A.thaliana]	82	1022	1e-104
Cf-9 [L. pimpinellifolium]	93	716	1e-48
FLS2 [A.thaliana]	156	652	4e-57
FLS2 [A.thaliana]	199	654	5e-38
CLV2 [A. thaliana]	278	696	3e-28
Pto [L. esculentum]	779	1025	9e-37
Rpg1 [Hordeum vulgare]	784	1005	1e-27
Rpg1 [Hordeum vulgare]	784	987	3e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	27	in -> out
putative TM domain	5	27	in -> out
putative TM domain	703	725	out -> in
putative TM domain	703	725	out -> in
putative TM domain	787	806	in -> out
putative TM domain	787	806	in -> out

Report for 1978.m00149

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)