Report for 2176.m00409

 > 2176.m00409, length: 737, copies: 1 

MAPVVHRFFLVDVVVLFAAAAAAAIPASAEAAASSSQTDALLAWKASLDDAASLSDWTRAAPVCTWRGVACDAAG

SVASLRLRSLRLRGGIHALDFAALPALTELDLNDNYLVGAIPARISRLRSLASLDLGSNWFDGSIPPQFGDLSGL

VDLRLYNNNLVGAIPHQLSRLPKIAHVDLGANYLTGLDFRKFSPMPTMTFLSLFLNSLNGSFPEFVIRSGNLTFL

DLSHNNFSGSIPDMLPEKLPNLMYLNLSFNAFSGQIPASIGRLTKLLDLRIDSNNLTGGVPVFLGSMSQLKVLDL

GFNPLGGTIPPVLGQLQMLQQLSIMNAELVSTLPPELGNLKNLTVMELSMNQLSGGLPPEFAGMQAMRVFSISTN

NLTGEIPPALFTSWPELISFQVQNNLFTGKIPPELGKAGKLIVLFMFGNRLSGSIPAALGSLTSLEDLDLSDNDL

TGGIPPELGHLSHLTFLKLSHNSISGPIPGNMGNNFKMQGVDHSSGNSSNSRSGSDFCQLLSLKILYLSNNKLTG

KLPDCWWNLQNLQFIDLSNNAFSGEIPTVQTNYNCSLESVHLADNGFTGVFPSSLEMCKALITLDIGNNRFFGGI

PPWIGKGLLSLKFLSLKSNNFTGEIPSELSNLSQLQLLDISNNGLTGLIPKSFGNLTSMKNPNTLSAQETLEWSS

YINWLLYSDGIDTIWKGQEQFFEKTIELLTGINLSGAIPPSLADISTLDILNLSNNHLSGLF

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	101	124	0.7
LRR [Pfam ls]	125	148	0.26
LRR [Pfam ls]	149	172	0.37
LRR [Pfam fs]	221	245	2.9e-05
LRR [Pfam ls]	221	245	0.00047
LRR [Pfam ls]	246	269	0.48
LRR [Pfam ls]	294	317	0.018
LRR [Pfam ls]	342	365	0.58
LRR [Pfam ls]	366	390	3.3
LRR [Pfam ls]	415	438	0.4
LRR [Pfam fs]	439	462	1.2e-05
LRR [Pfam ls]	439	462	0.0002
LRR [Pfam ls]	463	487	0.33
LRR [Pfam ls]	512	535	0.013
LRR [Pfam ls]	536	556	1.9
LRR [Pfam ls]	610	633	0.054
LRR [Pfam fs]	634	657	2e-06
LRR [Pfam ls]	634	657	2.9e-05

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	76	100	1.5
LRR [sensitive, ls]	76	100	35
LRR [sensitive, ls]	101	124	0.03
LRR [sensitive, ls]	101	124	0.7
LRR [sensitive, ls]	125	148	0.011
LRR [sensitive, ls]	125	148	0.26
LRR [sensitive, ls]	149	172	0.016
LRR [sensitive, ls]	149	172	0.37
LRR [sensitive, ls]	173	196	1.9
LRR [sensitive, ls]	173	196	45
LRR [sensitive, ls]	221	245	2e-05
LRR [sensitive, ls]	221	245	0.00047
LRR [sensitive, ls]	246	269	0.021
LRR [sensitive, ls]	246	269	0.48
LRR [sensitive, ls]	270	293	0.3
LRR [sensitive, ls]	270	293	7.1
LRR [sensitive, ls]	294	317	0.00076
LRR [sensitive, ls]	294	317	0.018
LRR [sensitive, ls]	318	341	0.98
LRR [sensitive, ls]	318	341	23
LRR [sensitive, ls]	342	365	0.025
LRR [sensitive, ls]	342	365	0.58
LRR [sensitive, ls]	366	390	0.14
LRR [sensitive, ls]	366	390	3.3
LRR [sensitive, ls]	391	414	0.98
LRR [sensitive, ls]	391	414	23
LRR [sensitive, ls]	415	438	0.017
LRR [sensitive, ls]	415	438	0.4
LRR [sensitive, ls]	439	462	8.4e-06
LRR [sensitive, ls]	439	462	0.0002
LRR [sensitive, ls]	463	487	0.014
LRR [sensitive, ls]	463	487	0.33
LRR [sensitive, ls]	512	535	0.00054
LRR [sensitive, ls]	512	535	0.013
LRR [sensitive, ls]	536	556	0.083
LRR [sensitive, ls]	536	556	1.9
LRR [sensitive, ls]	561	584	0.25
LRR [sensitive, ls]	561	584	5.9
LRR [sensitive, ls]	585	609	0.39
LRR [sensitive, ls]	585	609	9.1
LRR [sensitive, ls]	610	633	0.0023
LRR [sensitive, ls]	610	633	0.054
LRR [sensitive, ls]	634	657	1.2e-06
LRR [sensitive, ls]	634	657	2.9e-05

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	15	618	1e-70
FLS2 [A.thaliana]	37	735	2e-86
CLV2 [A. thaliana]	40	658	2e-54
Cf-9 [L. pimpinellifolium]	57	735	2e-58
CLV2 [A. thaliana]	68	483	2e-34
FLS2 [A.thaliana]	69	661	2e-77
FLS2 [A.thaliana]	79	561	2e-60
Cf-9 [L. pimpinellifolium]	89	497	7e-42
FLS2 [A.thaliana]	94	652	6e-78
Cf-9 [L. pimpinellifolium]	102	661	2e-49
CLV2 [A. thaliana]	102	607	2e-46
FLS2 [A.thaliana]	183	735	6e-60
CLV2 [A. thaliana]	196	735	2e-53
Cf-9 [L. pimpinellifolium]	201	737	8e-38
Xa21 [O. sativa]	225	735	2e-56
CLV2 [A. thaliana]	236	696	2e-42

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2176.m00409

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)