Report for 2345.m00099

 > 2345.m00099, length: 977, copies: 1 

MTPLLLLLLALAAGAGAASFPADFANLFAAKAALSDPSSALAAWDPGLSPSLSPCRWPHLLCSNPSSSSSAAIAA

VLLSNLSLAGEFPAPLCELRSLALLDLSYNDLTGPLPGCLAAMPSLRHLDLAGNGFSGEVPRSYGAGFPSLLTLS

LAGNELSGELPAFLANVSALEELLLAYNQFAPSPLPETFTGIRRLQVLWLAGCNLVGDIPPSIGSLKSLVNLDLS

TNNLTGEIPSSIGGLESVVQLELYSNQLTGSLPEGMSALKKLRFFDAAMNQLSGEIPADLFLAPRLESLHLYQNE

LTGRVPATVADAAALNDLRLFTNRLVGELPPEFGKKSPLEFLDLSDNRISGEIPATLCSAGKLEQLLMLNNELVG

PIPAELGQCRTLTRVRLPNNRLSGAVPPDMWGLPHLYLLELAGNALSGAVAPAIATARNLSQLLISDNRFAGALP

PELGSLPNLFELSASNNVFSGPLPASLTVVTTLGRLDLRNNSLSGELPRGVRRWQKLTQLDLADNRLTGNIPAEL

GDLPVLNSLDLSNNELTGGVPVQLENLKLSLLNLSNNRLAGVLPPLFAGEMYKDSFLGNPGLCTGGSCSSGRRAR

AGRRGLVGSVTVAVAGVILLLGAAWFAHRYRSQRRWSTEDAAGEKSRWVVTSFHKAEFDEEDILSCLDDEDNVVG

TGAAGKVYKAVLGNGARGGDDGAVVAVKKLWANGGAAKKAAAMEAGGGGGGGGKDTFEAEVATLGRIRHKNIVKL

WCSLSSGDRRLLVYEYMPNGSLGDLLHGGKGGLLDWPARHRIMVDAAEGLSYLHHDCAPPIVHRDVKSNNILLDA

DLRAKVADFGVARAVSAAPPTAVSAIAGSCGYIAPEYSYTLRITEKSDVYSFGVVMLELLTGKAPAGPELGEKDL

VRWVCGCVERDGVDRVLDARLAGAPRDETRRALNVALLCASSLPINRPSMRSVVKLLLELRPESKEKAMAEEKPL

LV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	96	119	0.22
LRR [Pfam ls]	120	144	0.13
LRR [Pfam ls]	145	168	3.6
LRR [Pfam ls]	194	217	0.067
LRR [Pfam ls]	218	241	0.043
LRR [Pfam ls]	242	265	1.3
LRR [Pfam ls]	338	361	3.5
LRR [Pfam ls]	386	409	7
LRR [Pfam ls]	434	457	1.5
LRR [Pfam ls]	482	505	7.7
LRR [Pfam ls]	506	529	0.0097
LRR [Pfam ls]	530	550	6.1
LRR [Pfam ls]	553	576	3.3
Ser/Thr pkinase [Pfam ls]	668	959	1.5e-39
Ser/Thr pkinase [Pfam fs]	673	890	4.7e-44

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	96	119	0.011
LRR [sensitive, ls]	96	119	0.22
LRR [sensitive, ls]	120	144	0.0066
LRR [sensitive, ls]	120	144	0.13
LRR [sensitive, ls]	145	168	0.18
LRR [sensitive, ls]	145	168	3.6
LRR [sensitive, ls]	169	193	2.3
LRR [sensitive, ls]	169	193	47
LRR [sensitive, ls]	194	217	0.0033
LRR [sensitive, ls]	194	217	0.067
LRR [sensitive, ls]	218	241	0.0021
LRR [sensitive, ls]	218	241	0.043
LRR [sensitive, ls]	242	265	0.063
LRR [sensitive, ls]	242	265	1.3
LRR [sensitive, ls]	290	313	0.5
LRR [sensitive, ls]	290	313	10
LRR [sensitive, ls]	314	337	2.2
LRR [sensitive, ls]	314	337	45
LRR [sensitive, ls]	338	361	0.17
LRR [sensitive, ls]	338	361	3.5
LRR [sensitive, ls]	362	385	6.3
LRR [sensitive, ls]	362	385	130
LRR [sensitive, ls]	386	409	0.35
LRR [sensitive, ls]	386	409	7
LRR [sensitive, ls]	410	433	1.1
LRR [sensitive, ls]	410	433	23
LRR [sensitive, ls]	434	457	0.075
LRR [sensitive, ls]	434	457	1.5
LRR [sensitive, ls]	458	481	1.2
LRR [sensitive, ls]	458	481	24
LRR [sensitive, ls]	482	505	0.38
LRR [sensitive, ls]	482	505	7.7
LRR [sensitive, ls]	506	529	0.00048
LRR [sensitive, ls]	506	529	0.0097
LRR [sensitive, ls]	530	550	0.3
LRR [sensitive, ls]	530	550	6.1
LRR [sensitive, ls]	553	576	0.16
LRR [sensitive, ls]	553	576	3.3

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	2	573	1e-72
Xa21 [O. sativa]	3	777	3e-70
CLV2 [A. thaliana]	21	546	8e-57
Cf-9 [L. pimpinellifolium]	51	576	3e-41
Cf-9 [L. pimpinellifolium]	58	587	2e-50
CLV2 [A. thaliana]	70	593	1e-47
FLS2 [A.thaliana]	73	961	1e-105
FLS2 [A.thaliana]	78	569	3e-71
FLS2 [A.thaliana]	205	578	3e-55
Pto [L. esculentum]	652	961	3e-33
Rpg1 [Hordeum vulgare]	670	957	3e-30
Rpg1 [Hordeum vulgare]	670	955	1e-19

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	605	627	out -> in

Report for 2345.m00099

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)