Report for 2456.m00167

 > 2456.m00167, length: 333, copies: 1 

MAALLECFLLAVAVVLVAHAAAPAPAASSRLPLPPPPAAAAGDVSGSDSDRRALMAFKKLVSGDPSQALESWGDG

STPLCRWHGVSCGVAAGRRRGRVVALDLAGAGIAGEVSPALGNLTHLRRLHLPENRLHGALPWQLGRLGELRHLN

LSHNSIAGRIPPPLISGCRRLKNVLLHGNRLHGELPGELLSSLRRLEVLDLGKNTLTGSIPPDIGNLVSLKQLVL

EFNNLTGQIPSQIGKLGNLTMLSLSSNQLSGSIPESIGNLSALTAIAAFSNNLTGRIPPLERLSSLSYLGLASNN

LGGTIPSWLGNLSSLTALDLQSNGFVGCIPESL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	145	169	0.004
LRR [Pfam ls]	170	194	1
LRR [Pfam ls]	195	218	0.0076
LRR [Pfam ls]	219	242	1.5
LRR [Pfam ls]	243	266	0.0089
LRR [Pfam ls]	290	313	0.51

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	97	120	1.4
LRR [sensitive, ls]	97	120	29
LRR [sensitive, ls]	121	144	0.6
LRR [sensitive, ls]	121	144	12
LRR [sensitive, ls]	145	169	0.00019
LRR [sensitive, ls]	145	169	0.004
LRR [sensitive, ls]	170	194	0.048
LRR [sensitive, ls]	170	194	1
LRR [sensitive, ls]	195	218	0.00036
LRR [sensitive, ls]	195	218	0.0076
LRR [sensitive, ls]	219	242	0.072
LRR [sensitive, ls]	219	242	1.5
LRR [sensitive, ls]	243	266	0.00043
LRR [sensitive, ls]	243	266	0.0089
LRR [sensitive, ls]	267	289	2.8
LRR [sensitive, ls]	267	289	57
LRR [sensitive, ls]	290	313	0.024
LRR [sensitive, ls]	290	313	0.51

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	42	333	6e-43
FLS2 [A.thaliana]	53	333	1e-42
Cf-9 [L. pimpinellifolium]	71	329	1e-18
CLV2 [A. thaliana]	74	333	8e-28
FLS2 [A.thaliana]	89	333	3e-31
CLV2 [A. thaliana]	97	331	4e-16
Cf-9 [L. pimpinellifolium]	98	331	3e-25
CLV2 [A. thaliana]	98	333	4e-26
CLV2 [A. thaliana]	98	333	3e-23
FLS2 [A.thaliana]	98	333	3e-34
Xa21 [O. sativa]	98	330	7e-30
Cf-9 [L. pimpinellifolium]	101	333	3e-21
Cf-9 [L. pimpinellifolium]	101	331	5e-19
CLV2 [A. thaliana]	101	331	2e-30
FLS2 [A.thaliana]	101	330	2e-31
FLS2 [A.thaliana]	101	333	2e-31
FLS2 [A.thaliana]	101	323	5e-27
Xa21 [O. sativa]	101	333	2e-28
Xa21 [O. sativa]	101	331	1e-26
Xa21 [O. sativa]	101	330	1e-25
Cf-9 [L. pimpinellifolium]	103	333	3e-20
FLS2 [A.thaliana]	108	333	2e-31
FLS2 [A.thaliana]	108	329	8e-28
FLS2 [A.thaliana]	108	286	2e-19
Xa21 [O. sativa]	115	333	8e-27
Cf-9 [L. pimpinellifolium]	116	300	1e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2456.m00167

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)