Report for 2487.m00085

 > 2487.m00085, length: 501, copies: 2 

MDPTPQSHPILAYVLSRLPSLLPVSPSLSTPRARDIEQPSPRAPSGAAEFDLVSRMPGLRHPSVLSAMTRAVADV

SSARDALRLLGPRPDHELVDSARAFLRSHAAEEAEEEEEDEKVAKSREVVRLDEAHESYGGLLREAEERLDRVYR

TAMRGRDMQVVAAAHGGGGEEEAGVVDDEVVRVLRDAEEGKAVERLLLADRQLRHLPEQLGRIRGLLVLDVSRNQ

LKNVPDAIGGLEHLEELRLASNALVSLPDSIGLLTSLKILDVSGNKLRSLPDSISKCRSLVELDVSYNVLSYLPT

GIGQEMARLEKLWVHLNKLRSLPSSVCEMRSLRLLDAHFNQLRGLPAGIGRLAALESLNLSSNFSDMRDLPASFG

DLLGLRELDLSNNQIHALPDCFGRLQRLERLRLDQNPLAVPPKEVVAGGVGAVKEYMARRWRDARAEEERRGSAV

AESPRVSTPKEWLVRSVSSLGSWVSDVTRYGAGQDKAAAEEEEDAYLQQNL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	215	237	0.82
LRR [Pfam ls]	238	260	0.21
LRR [Pfam ls]	261	283	0.018
LRR [Pfam ls]	284	307	1.9
LRR [Pfam ls]	331	353	0.77
LRR [Pfam ls]	379	401	0.0071

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	215	237	0.039
LRR [sensitive, ls]	215	237	0.82
LRR [sensitive, ls]	238	260	0.01
LRR [sensitive, ls]	238	260	0.21
LRR [sensitive, ls]	261	283	0.00089
LRR [sensitive, ls]	261	283	0.018
LRR [sensitive, ls]	284	307	0.094
LRR [sensitive, ls]	284	307	1.9
LRR [sensitive, ls]	308	330	0.92
LRR [sensitive, ls]	308	330	19
LRR [sensitive, ls]	331	353	0.037
LRR [sensitive, ls]	331	353	0.77
LRR [sensitive, ls]	354	378	0.69
LRR [sensitive, ls]	354	378	14
LRR [sensitive, ls]	379	401	0.00034
LRR [sensitive, ls]	379	401	0.0071
LRR [sensitive, ls]	402	425	1.3
LRR [sensitive, ls]	402	425	26

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	138	363	1e-10
FLS2 [A.thaliana]	195	420	7e-16
FLS2 [A.thaliana]	206	400	8e-15
FLS2 [A.thaliana]	206	426	8e-14
Xa21 [O. sativa]	206	413	3e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2487.m00085

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)