Report for 2507.m00093

 > 2507.m00093, length: 1143, copies: 2 

MQPPHFSYKTQSNRLPIPVLSLALVLLLNFTSPTSSCTEQEKNSLLNFLTGLSKDGGLSMSWKDGVDCCEWEGIT

CRTDRTVTDVSLPSRSLEGYISPSLGNLTGLLRLNLSYNLLSSVLPQELLSSSKLIVIDISFNRLNGGLDKLPSS

TPARPLQVLNISSNLLAGQFPSSTWVVMTNLAALNVSNNSFTGKIPTNFCTNSPSLAVLELSYNQFSGSIPPELG

SCSRLRVLKAGHNNLSGTLPDEIFNATSLECLSFPNNNLQGTLEGANVVKLGKLATLDLGENNFSGNIPESIGQL

NRLEELHLNNNKMFGSIPSTLSNCTSLKTIDLNSNNFSGELMNVNFSNLPSLQTLDLRQNIFSGKIPETIYSCSN

LTALRLSLNKFQGQLSKGLGNLKSLSFLSLGYNNLTNITNALQILRSSSKLTTLLISNNFMNESIPDDDRIDGFE

NLQVLDLSGCSFSGKIPQWLSKLSRLEMLVLDNNQLTGPIPDWISSLNFLFYLDVSNNNLTGEIPMALLQMPMLR

SDRAAAQLDTRAFELPVYIDATLLQYRKASAFPKVLNLGNNEFTGLIPQEIGQLKALLLLNLSFNKLYGDIPQSI

CNLRDLLMLDLSSNNLTGTIPAALNNLTFLIEFSVSYNDLEGPIPTGGQFSTFTNSSFYGNPKLCGPMLTHHCSS

FDRHLVSKKQQNKKQGKEAENKLTFTGIVEATNNFNQEHIIGCGGYGLVYKAQLPDGSMIAIKKLNGEMCLMERE

FSAEVETLSMARHDNLVPLWGYCIQGNSRLLIYSYMENGSLDDWLHNKDDDTSTILDWPRRLKIAKGASHGLSYI

HNICKPRIVHRDIKSSNILLDKEFKAYIADFGLSRLILPNKTHVTTELVGTLGYIPPEYAQAWVATLKGDVYSFG

VVLLELLTGRRPVPILSTSKELVPWVQEMVSNGKQIEVLDLTFQGTGCEEQMLKVLEIACKCVKVDTTIISCGIR

EYHTSTNATSPSLEWEENAAQLTSRSGSTVAAHEIFDGRSRHRPGLDKRLSSISPNTLNASPQAAKKRLRLRSTR

PALALRRTVEGSRRRATAGFPVEEKRPRVVAEAQERETGPQIRPPCRRRSPPPPPPLIFWEKMGSFWARVGPEEK

RPHEAHEFQPNLRQLLSY

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	180	204	0.86
LRR [Pfam ls]	205	228	0.038
LRR [Pfam ls]	229	252	1.9
LRR [Pfam ls]	278	301	0.67
LRR [Pfam ls]	302	325	0.068
LRR [Pfam ls]	326	350	0.29
LRR [Pfam ls]	351	374	2.4
LRR [Pfam ls]	375	398	6
LRR [Pfam ls]	399	421	6.4
LRR [Pfam ls]	451	474	0.0023
LRR [Pfam ls]	475	498	0.058
LRR [Pfam ls]	499	522	1.9
LRR [Pfam ls]	557	580	5.6
LRR [Pfam ls]	581	604	4.1
LRR [Pfam ls]	605	628	0.031
Ser/Thr pkinase [Pfam fs]	710	914	5.3e-49
Ser/Thr pkinase [Pfam ls]	710	969	3.2e-40

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	105	128	1.1
LRR [sensitive, ls]	105	128	23
LRR [sensitive, ls]	129	151	0.82
LRR [sensitive, ls]	129	151	17
LRR [sensitive, ls]	155	179	0.67
LRR [sensitive, ls]	155	179	14
LRR [sensitive, ls]	180	204	0.041
LRR [sensitive, ls]	180	204	0.86
LRR [sensitive, ls]	205	228	0.0018
LRR [sensitive, ls]	205	228	0.038
LRR [sensitive, ls]	229	252	0.092
LRR [sensitive, ls]	229	252	1.9
LRR [sensitive, ls]	253	277	2.1
LRR [sensitive, ls]	253	277	45
LRR [sensitive, ls]	278	301	0.032
LRR [sensitive, ls]	278	301	0.67
LRR [sensitive, ls]	302	325	0.0033
LRR [sensitive, ls]	302	325	0.068
LRR [sensitive, ls]	326	350	0.014
LRR [sensitive, ls]	326	350	0.29
LRR [sensitive, ls]	351	374	0.12
LRR [sensitive, ls]	351	374	2.4
LRR [sensitive, ls]	375	398	0.29
LRR [sensitive, ls]	375	398	6
LRR [sensitive, ls]	399	421	0.31
LRR [sensitive, ls]	399	421	6.4
LRR [sensitive, ls]	425	445	5
LRR [sensitive, ls]	425	445	100
LRR [sensitive, ls]	451	474	0.00011
LRR [sensitive, ls]	451	474	0.0023
LRR [sensitive, ls]	475	498	0.0028
LRR [sensitive, ls]	475	498	0.058
LRR [sensitive, ls]	499	522	0.093
LRR [sensitive, ls]	499	522	1.9
LRR [sensitive, ls]	557	580	0.27
LRR [sensitive, ls]	557	580	5.6
LRR [sensitive, ls]	581	604	0.2
LRR [sensitive, ls]	581	604	4.1
LRR [sensitive, ls]	605	628	0.0015
LRR [sensitive, ls]	605	628	0.031
LRR [sensitive, ls]	629	651	6.3
LRR [sensitive, ls]	629	651	130

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	19	801	2e-83
FLS2 [A.thaliana]	39	645	1e-66
CLV2 [A. thaliana]	40	665	2e-51
Cf-9 [L. pimpinellifolium]	59	636	2e-41
FLS2 [A.thaliana]	81	941	1e-102
CLV2 [A. thaliana]	85	504	1e-39
Cf-9 [L. pimpinellifolium]	100	704	1e-64
CLV2 [A. thaliana]	151	652	1e-41
Cf-9 [L. pimpinellifolium]	159	646	1e-39
FLS2 [A.thaliana]	485	661	3e-13
Rpg1 [Hordeum vulgare]	697	910	2e-36
Pto [L. esculentum]	705	967	1e-44
Rpg1 [Hordeum vulgare]	707	910	2e-28

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2507.m00093

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)