Report for 2507.m00094

 > 2507.m00094, length: 1046, copies: 2 

MQPPHSSCKTQSNRFPIPVLGLALVLLLNFTSPTSSCTKQEKSTLLNFLTGFSQDGGLSMSWKDGMDCCEWEGIN

CSQDKTVTEVSLPSRSLEGHISPSLGNLTGLLRLNLSYNLLSGAIPQELVSSRSLIVIDISFNRLNGGLDELPSS

TPARPLQVLNISSNLFKGQFPSSTWKVMKNLVKLNVSNNSFSGHIPTNFCTNSPSFAVLELSYNQFSGGVPPELG

NCSMLRVLKAGNNNLSGTLPDELFNATSLDCLSFPNNNLEGNIGSTPVVKLSNVVVLDLGGNNFSGMIPDTIGQL

SRLQELHLDNNNLHGELPSALGNCKYLTTINLKSNSFSGDLGKVNFSTLPNLKTLDIDMNNFSGKVPESIYSCSN

LIALRLSYNNFYGELSSEIGKLKYLSFLSLSNNSFTNITRALQILKSSTNLTTLFIAYNFMEEVIPQDETIDGFE

NLQALSVDHCSLSGRIPLWLSKLTNLKLLFLSNNQLTGPIPDWISSLNRLFYLDISNNSLAGEIPITLMDMPMIR

TTQNKTYSEPSFFELPVYDGKFLQYRTRTAFPTLLNLSLNKFMGVIPPQIGQLKMLVVLDFSHNNLSGQIPQSVC

SLTSLRVLDLSNNNLTGSIPGELNSLNFLSAFNVSNNDLEGPIPIGAQFSTFPNSSFDGNPKLCGSMLTHKCKSA

EEASASKKQLNKRVILAIVFGVLFGGAAIVLLLAHFLFSLRDAIPKIENKSNTSGNLEAGSFTSDPEHLLVMIPR

GSGEANKLTFTDLMEATDNFHKENIIACGGYGLVYKAELPSGSTLAIKKLNGEMCLMEREFAAEVEALSMAQHDN

LVPLWGYCIQGNSRLLIYSYMENGSLDDWLHNRDDETSSFLDWPTRFKIARGASQGLSYIHDVCKPHIVHRDIKS

SNILLDKEFKAYVADFGLSRLILPNKNHITTELVGTLGYIPPEYGQGWVATLRGDVYSFGVVLLELLTGRRPVSI

LSTSEELVPWVLEMKSKGNMLEVLDPTLQGTGNEEQMLKVLEVACKCVNCNPCMRPTITEVVSCLDSVGSD

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	155	179	5.5
LRR [Pfam ls]	180	204	0.18
LRR [Pfam ls]	205	228	0.98
LRR [Pfam ls]	229	253	3.3
LRR [Pfam ls]	278	301	0.021
LRR [Pfam ls]	302	325	0.0082
LRR [Pfam ls]	375	398	6.1
LRR [Pfam ls]	451	474	0.7
LRR [Pfam ls]	475	498	0.0022
LRR [Pfam ls]	499	522	2.6
LRR [Pfam ls]	580	603	0.41
LRR [Pfam fs]	604	627	3.8e-05
LRR [Pfam ls]	604	627	0.00063
Ser/Thr pkinase [Pfam fs]	770	974	3.4e-48
Ser/Thr pkinase [Pfam ls]	770	1042	7e-47

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	81	104	5
LRR [sensitive, ls]	81	104	100
LRR [sensitive, ls]	105	128	0.48
LRR [sensitive, ls]	105	128	10
LRR [sensitive, ls]	129	151	0.63
LRR [sensitive, ls]	129	151	13
LRR [sensitive, ls]	155	179	0.27
LRR [sensitive, ls]	155	179	5.5
LRR [sensitive, ls]	180	204	0.0085
LRR [sensitive, ls]	180	204	0.18
LRR [sensitive, ls]	205	228	0.047
LRR [sensitive, ls]	205	228	0.98
LRR [sensitive, ls]	229	253	0.16
LRR [sensitive, ls]	229	253	3.3
LRR [sensitive, ls]	278	301	0.001
LRR [sensitive, ls]	278	301	0.021
LRR [sensitive, ls]	302	325	0.0004
LRR [sensitive, ls]	302	325	0.0082
LRR [sensitive, ls]	326	350	0.73
LRR [sensitive, ls]	326	350	15
LRR [sensitive, ls]	351	374	1.1
LRR [sensitive, ls]	351	374	23
LRR [sensitive, ls]	375	398	0.29
LRR [sensitive, ls]	375	398	6.1
LRR [sensitive, ls]	399	421	0.44
LRR [sensitive, ls]	399	421	9.2
LRR [sensitive, ls]	425	445	6.5
LRR [sensitive, ls]	425	445	140
LRR [sensitive, ls]	451	474	0.034
LRR [sensitive, ls]	451	474	0.7
LRR [sensitive, ls]	475	498	0.0001
LRR [sensitive, ls]	475	498	0.0022
LRR [sensitive, ls]	499	522	0.12
LRR [sensitive, ls]	499	522	2.6
LRR [sensitive, ls]	556	579	3.3
LRR [sensitive, ls]	556	579	68
LRR [sensitive, ls]	580	603	0.02
LRR [sensitive, ls]	580	603	0.41
LRR [sensitive, ls]	604	627	3.1e-05
LRR [sensitive, ls]	604	627	0.00063
LRR [sensitive, ls]	628	661	2
LRR [sensitive, ls]	628	661	41

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	12	515	7e-37
FLS2 [A.thaliana]	24	644	7e-72
CLV2 [A. thaliana]	40	685	2e-49
Xa21 [O. sativa]	41	856	2e-82
Cf-9 [L. pimpinellifolium]	59	679	5e-62
FLS2 [A.thaliana]	75	409	8e-38
FLS2 [A.thaliana]	80	339	2e-30
FLS2 [A.thaliana]	82	1040	1e-107
FLS2 [A.thaliana]	456	671	3e-13
Pto [L. esculentum]	752	1037	7e-45
Rpg1 [Hordeum vulgare]	754	1044	3e-36
Rpg1 [Hordeum vulgare]	763	1043	3e-32

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	15	32	out -> in
putative TM domain	689	711	in -> out

Report for 2507.m00094

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)