Report for 2507.m00095

 > 2507.m00095, length: 1141, copies: 2 

MDCDRYSSKLPTISSLSLGLLLLISLASLTSSCTEQEKGSLHQFLAELSQDGNLSMSWRNDRNCCVWEGITCNRN

GAVTDISLQSKGLEGHISPSLGNLTSLLRLNLSHNSLSGYLPWELVSSSSISVLDVSFNRLRGELQDPLSPMTAV

RPLQVLNISSNSFTGQFPSTTWKAMKNLVALNASNNRFTGQISDHFCSSSPSLMVLDLCYNLFSGGIPPGIGACS

RLNVLKVGQNNLSGTLPDELFNATSLEHLSVPNNGLNGTLDSAHIMKLSNLVTLDLGGNNFNGRIPESIGELKKL

EELLLGHNNMYGEVPSTLSNCTNLKTIDIKSNSFSGELSKINFSTLPNLQTLDLLLNNFNGTIPQNIYSCSNLIA

LRMSSNKFHGQLPKGIGNLKSLSFLSISNNSLTNITDTLQILKNSRSLSTLLMGVNFNGELMPEDETIDGFENLQ

FVSIDDCSLIGNIPFWLSKLTNLQMLDLSNNQLTGQIPAWINRLNFLFYLDISNNSLTGGIPTALMEIPRLISAN

STPYFDPGILQLPIYTGPSLEYRGFRAFPATLNLARNHLMGAIPQEIGQLKMLRTLNISFNSISGEIPQPLCNLT

DLQVLDLSNNHLIGTIPSALNNLHFLSKLNVSNNDLEGSIPTGGQFSTFQNSSFVGNSKLCGSNIFRSCDSSRAP

SVSRKQHKKKVILAITLSVSVGGIIILLSLSSLLVSLRATKLMRKGELANNRNEETASFNPNSDHSLMVMPQGKG

DNNKLTFADIMKTTNNFDKENIIGCGGYGLVYKAELPDGSKLAIKKLNSEMCLMEREFTAEIEALTMAQHDNLVP

LWGYCIHGNSRLLIYSYMENGSLDDWLHNRDDDASSFLDWPTRLKIAQGASLGISYIHDVCKPHIVHRDIKSSNI

LLDKEFKAYIADFGLSRLILPSKTHVTTELVGTLGYIPPEYGQSWIATLRGDIYSFGVVLLELLTGRRPVPLLST

SKELVPWVQEMRSVGKQIEVLDPTVRGMGYDEQMLKVLETACKCVNYNPLMRPTIMEVVASLDIRSPRLVTDYYH

FRALSAERIRLALILHLFVETLFMLKLYRHDKKVETTSKRICNKVADRMASYGAVTVAPGSTCYWSQAPEFVTSL

VSASPAICPRLLVNGN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	101	124	4.1
LRR [Pfam ls]	152	176	4.7
LRR [Pfam ls]	177	201	2.6
LRR [Pfam ls]	202	225	6.4
LRR [Pfam ls]	226	249	8
LRR [Pfam ls]	275	298	0.055
LRR [Pfam ls]	299	322	3.5
LRR [Pfam ls]	372	395	7
LRR [Pfam ls]	396	418	5.1
LRR [Pfam ls]	448	471	8.5
LRR [Pfam ls]	472	495	0.008
LRR [Pfam ls]	496	519	2.9
LRR [Pfam ls]	577	600	0.22
LRR [Pfam ls]	601	624	0.0058
Ser/Thr pkinase [Pfam fs]	767	1039	4e-49
Ser/Thr pkinase [Pfam ls]	767	1039	1.1e-49

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	101	124	0.19
LRR [sensitive, ls]	101	124	4.1
LRR [sensitive, ls]	125	148	0.51
LRR [sensitive, ls]	125	148	11
LRR [sensitive, ls]	152	176	0.23
LRR [sensitive, ls]	152	176	4.7
LRR [sensitive, ls]	177	201	0.13
LRR [sensitive, ls]	177	201	2.6
LRR [sensitive, ls]	202	225	0.31
LRR [sensitive, ls]	202	225	6.4
LRR [sensitive, ls]	226	249	0.39
LRR [sensitive, ls]	226	249	8
LRR [sensitive, ls]	250	274	0.53
LRR [sensitive, ls]	250	274	11
LRR [sensitive, ls]	275	298	0.0027
LRR [sensitive, ls]	275	298	0.055
LRR [sensitive, ls]	299	322	0.17
LRR [sensitive, ls]	299	322	3.5
LRR [sensitive, ls]	323	347	0.61
LRR [sensitive, ls]	323	347	13
LRR [sensitive, ls]	348	371	2.9
LRR [sensitive, ls]	348	371	61
LRR [sensitive, ls]	372	395	0.33
LRR [sensitive, ls]	372	395	7
LRR [sensitive, ls]	396	418	0.25
LRR [sensitive, ls]	396	418	5.1
LRR [sensitive, ls]	448	471	0.41
LRR [sensitive, ls]	448	471	8.5
LRR [sensitive, ls]	472	495	0.00038
LRR [sensitive, ls]	472	495	0.008
LRR [sensitive, ls]	496	519	0.14
LRR [sensitive, ls]	496	519	2.9
LRR [sensitive, ls]	553	576	3.1
LRR [sensitive, ls]	553	576	65
LRR [sensitive, ls]	577	600	0.011
LRR [sensitive, ls]	577	600	0.22
LRR [sensitive, ls]	601	624	0.00028
LRR [sensitive, ls]	601	624	0.0058
LRR [sensitive, ls]	625	647	0.48
LRR [sensitive, ls]	625	647	9.9

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	9	641	2e-71
Xa21 [O. sativa]	16	858	7e-91
Cf-9 [L. pimpinellifolium]	27	649	4e-48
CLV2 [A. thaliana]	36	687	7e-63
Cf-9 [L. pimpinellifolium]	73	669	5e-56
FLS2 [A.thaliana]	77	1037	1e-108
FLS2 [A.thaliana]	317	642	6e-20
Pto [L. esculentum]	751	1038	5e-46
Rpg1 [Hordeum vulgare]	754	1037	4e-37
Rpg1 [Hordeum vulgare]	754	1038	2e-31

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	688	710	out -> in

Report for 2507.m00095

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)