Report for 2517.m00085

 > 2517.m00085, length: 884, copies: 1 

MTTTTTTRLLLAAILLAVAAADDDGQTLLEIKKSFRNVDNVLYDWAGDGAPRRYCSWRGVLCDNVTFAVAALDLK

SNELSGQIPDEIGDCTSLKTLILKNNQLVGMIPSTLSQLPNLKILDLAQNKLNGEIPRLIYWNEVLQYLRLNICN

VGQIVRGLRSNNLEGSLSPEMCQLTGLWYLDLSYNRLTGEIPFNIGFLQVATLSLQGNNFSGPIPSVIGLMQALA

VLDLSFNQLSGPIPSILGNLTYTEKLYLQGNRLTGSIPPELGNMSTLHYLNLANNNLEGPIPDNISSCMNLISLN

LSSNYLSGAIPIELAKMKNLDTLDLSCNMVAGPIPSAIGSLEHLLRLNFSNNNLVGYIPAEFGNLRSIMEIFLFL

CFSDLSSNHLGGLIPQEVGMLQNLILLKLESNNITGDVSSLINCFSLNVLNVSYNNLAGIVPTDNNFSRFSPDSF

LGNPGLCGYWLGSSCYSTSHVQRSSVSRSAILGIAVAGLVILLMILAAACWPHWAQVPKDVSLCKPDIHALPSSN

VPPKLVILHMNMAFLVYEDIMRMTENLSEKYIIGYGASSTVYKCVLKNCKPVAIKKLYAHYPQSLKEFETELETV

GSIKHRNLVSLQGYSLSPAGNLLFYDYLENGSLWDVLHGSSKKQKLDWEARLRIALGAAQGLAYLHHDCNPRIIH

RDVKSKNILLDKDYEAHLADFGIAKSLCTSKTHTSTYVMGTIGYIDPEYACTSRLNEKSDVYSYGIVLLELLTGK

KPVDNECNLHHLILSKAADNTVMEMVDPDIADTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVLDCLVYPD

PPSKPALPPALPQSSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLKFGEVISQNTE

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	92	115	0.13
LRR [Pfam ls]	116	138	7.3
LRR [Pfam ls]	176	196	7.2
LRR [Pfam ls]	199	222	5.3
LRR [Pfam ls]	223	246	0.02
LRR [Pfam ls]	247	270	0.15
LRR [Pfam ls]	271	294	0.33
LRR [Pfam ls]	295	318	0.21
LRR [Pfam ls]	319	342	0.24
LRR [Pfam ls]	343	366	0.031
LRR [Pfam ls]	421	443	8
Ser/Thr pkinase [Pfam fs]	552	787	1.7e-40
Ser/Thr pkinase [Pfam ls]	552	815	2.4e-39

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	68	91	1.4
LRR [sensitive, ls]	68	91	30
LRR [sensitive, ls]	92	115	0.0063
LRR [sensitive, ls]	92	115	0.13
LRR [sensitive, ls]	116	138	0.35
LRR [sensitive, ls]	116	138	7.3
LRR [sensitive, ls]	140	162	4.6
LRR [sensitive, ls]	140	162	95
LRR [sensitive, ls]	176	196	0.35
LRR [sensitive, ls]	176	196	7.2
LRR [sensitive, ls]	199	222	0.25
LRR [sensitive, ls]	199	222	5.3
LRR [sensitive, ls]	223	246	0.00095
LRR [sensitive, ls]	223	246	0.02
LRR [sensitive, ls]	247	270	0.007
LRR [sensitive, ls]	247	270	0.15
LRR [sensitive, ls]	271	294	0.016
LRR [sensitive, ls]	271	294	0.33
LRR [sensitive, ls]	295	318	0.01
LRR [sensitive, ls]	295	318	0.21
LRR [sensitive, ls]	319	342	0.011
LRR [sensitive, ls]	319	342	0.24
LRR [sensitive, ls]	343	366	0.0015
LRR [sensitive, ls]	343	366	0.031
LRR [sensitive, ls]	398	420	1.3
LRR [sensitive, ls]	398	420	27
LRR [sensitive, ls]	421	443	0.38
LRR [sensitive, ls]	421	443	8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	9	437	1e-57
CLV2 [A. thaliana]	24	453	3e-47
Cf-9 [L. pimpinellifolium]	55	437	1e-35
Xa21 [O. sativa]	55	391	1e-33
Cf-9 [L. pimpinellifolium]	60	437	8e-38
CLV2 [A. thaliana]	64	310	9e-21
Xa21 [O. sativa]	68	644	1e-58
Cf-9 [L. pimpinellifolium]	69	364	4e-36
CLV2 [A. thaliana]	69	465	4e-38
Cf-9 [L. pimpinellifolium]	72	465	5e-39
CLV2 [A. thaliana]	72	363	5e-29
FLS2 [A.thaliana]	72	815	2e-99
FLS2 [A.thaliana]	72	450	2e-52
Xa21 [O. sativa]	72	449	3e-43
Xa21 [O. sativa]	199	437	1e-29
Rpg1 [Hordeum vulgare]	542	818	9e-34
Pto [L. esculentum]	543	819	2e-45
Rpg1 [Hordeum vulgare]	548	819	9e-25

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	479	501	in -> out

Report for 2517.m00085

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)