Report for 2685.m00137

 > 2685.m00137, length: 384, copies: 2 

MRGAGFLLLVVFAVAVAGGAVAAAADLDGGDGGGGVAAEWRFPSSRMRDAYVALQTWRREAIFSDPGNLTADWVG

PDVCNYTGVFCAPLPWDRREVAVAGVDLNHGDIAGYLPPELGLLADLALLHLNSNRFCGVLPATLRRLRLLHELD

LSNNRFVGRFPEVVLDMPALRFLDLRFNDFEGGVPRQLFDRPLDAIFLNHNRFRFDLPDNFGNSPVSVIVLAHNS

FGGCLPASLGNMSGTLNEILLINTGLSSCLPPEVGMLREVTVFDVSFNRLAGPLPSAVAGMRKVEQLDVAHNLLT

GAIPQAVCELPRLKNFTFAYNFFTGEPPSCAHAVPRYGDRRNCLPNRPAQRTLRHIETVCVAVVLKGIGKWWGCG

DLEDLGTYD

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	145	168	4.5
LRR [Pfam ls]	169	193	8.4
LRR [Pfam ls]	288	311	3.3

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	121	144	1
LRR [sensitive, ls]	121	144	20
LRR [sensitive, ls]	145	168	0.23
LRR [sensitive, ls]	145	168	4.5
LRR [sensitive, ls]	169	193	0.42
LRR [sensitive, ls]	169	193	8.4
LRR [sensitive, ls]	264	287	1.6
LRR [sensitive, ls]	264	287	31
LRR [sensitive, ls]	288	311	0.17
LRR [sensitive, ls]	288	311	3.3

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	22	342	5e-20
FLS2 [A.thaliana]	59	329	5e-21
CLV2 [A. thaliana]	73	329	1e-24
Xa21 [O. sativa]	79	329	3e-22
FLS2 [A.thaliana]	80	329	9e-19
FLS2 [A.thaliana]	81	329	1e-18
FLS2 [A.thaliana]	100	328	5e-20
FLS2 [A.thaliana]	100	328	5e-17
Cf-9 [L. pimpinellifolium]	101	325	8e-14
CLV2 [A. thaliana]	101	329	8e-25
FLS2 [A.thaliana]	101	328	8e-22
Xa21 [O. sativa]	101	329	2e-17
Xa21 [O. sativa]	101	225	3e-11
FLS2 [A.thaliana]	102	306	9e-11
Cf-9 [L. pimpinellifolium]	103	328	1e-10
CLV2 [A. thaliana]	103	326	4e-16
FLS2 [A.thaliana]	103	329	5e-17
FLS2 [A.thaliana]	104	328	6e-17
FLS2 [A.thaliana]	107	328	7e-21
Cf-9 [L. pimpinellifolium]	116	307	6e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	27	in -> out

Report for 2685.m00137

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)