Report for 2737.m00104

 > 2737.m00104, length: 906, copies: 2 

MSSIILTQTPSVPRRLLLLLQLSFLLLLSSASNAVTPAGVPCRPDQAAALLRLKRSFAVTSNSVTAFRSWRAGTD

CCGWEGVGCAAGAGANNGRAVTSLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHL

NLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGY

VDMSNSGAQWCDALANSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLN

HNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASG

FFGELPSSIAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISL

LGLSGNRFTSVGYDPLLPLQVDLLDLSNNMLEGSIPIPRGSSTSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNE

ISGNIPLEFCSAKSLQLLDLSYNNFNGSISSCLMDSVSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIE

GKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEFPAARIIDLASNN

FSGPLPQDQWFKKLKSMMIGYSNTSLVMDHEVPRVGRYKFSTTITYKGSAVTLTKILRTFVFIDVSENKFHGSIP

GTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQS

PHFSTFSSISFLGNKGLCGLPLSTGCSNTTSLNVIPSEKNPVDIVLFLSAGLGFGLGFAIAIVVAWGIPIRKRST

VRQRAL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	120	145	0.074
LRR [Pfam ls]	146	169	0.32
LRR [Pfam ls]	245	268	9.6
LRR [Pfam ls]	269	292	0.015
LRR [Pfam ls]	317	340	4.7
LRR [Pfam ls]	341	364	9.4
LRR [Pfam ls]	422	446	8.8
LRR [Pfam ls]	470	492	4.7
LRR [Pfam ls]	539	563	1.8
LRR [Pfam ls]	588	611	8.5
LRR [Pfam ls]	758	781	5.6
LRR [Pfam ls]	782	805	1
LRR [Pfam ls]	806	830	1.5

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	120	145	0.0038
LRR [sensitive, ls]	120	145	0.074
LRR [sensitive, ls]	146	169	0.016
LRR [sensitive, ls]	146	169	0.32
LRR [sensitive, ls]	170	194	4.8
LRR [sensitive, ls]	170	194	95
LRR [sensitive, ls]	245	268	0.49
LRR [sensitive, ls]	245	268	9.6
LRR [sensitive, ls]	269	292	0.00074
LRR [sensitive, ls]	269	292	0.015
LRR [sensitive, ls]	293	316	2.1
LRR [sensitive, ls]	293	316	41
LRR [sensitive, ls]	317	340	0.24
LRR [sensitive, ls]	317	340	4.7
LRR [sensitive, ls]	341	364	0.48
LRR [sensitive, ls]	341	364	9.4
LRR [sensitive, ls]	399	420	4.8
LRR [sensitive, ls]	399	420	95
LRR [sensitive, ls]	422	446	0.45
LRR [sensitive, ls]	422	446	8.8
LRR [sensitive, ls]	447	467	7.4
LRR [sensitive, ls]	447	467	140
LRR [sensitive, ls]	470	492	0.24
LRR [sensitive, ls]	470	492	4.7
LRR [sensitive, ls]	539	563	0.093
LRR [sensitive, ls]	539	563	1.8
LRR [sensitive, ls]	564	584	0.82
LRR [sensitive, ls]	564	584	16
LRR [sensitive, ls]	588	611	0.43
LRR [sensitive, ls]	588	611	8.5
LRR [sensitive, ls]	612	635	0.64
LRR [sensitive, ls]	612	635	13
LRR [sensitive, ls]	636	660	7.8
LRR [sensitive, ls]	636	660	150
LRR [sensitive, ls]	665	690	5.4
LRR [sensitive, ls]	665	690	110
LRR [sensitive, ls]	734	757	4.7
LRR [sensitive, ls]	734	757	92
LRR [sensitive, ls]	758	781	0.29
LRR [sensitive, ls]	758	781	5.6
LRR [sensitive, ls]	782	805	0.052
LRR [sensitive, ls]	782	805	1
LRR [sensitive, ls]	806	830	0.077
LRR [sensitive, ls]	806	830	1.5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	17	662	2e-41
Cf-9 [L. pimpinellifolium]	20	891	2e-97
FLS2 [A.thaliana]	77	839	1e-44
CLV2 [A. thaliana]	114	601	4e-24
FLS2 [A.thaliana]	114	581	2e-30
Xa21 [O. sativa]	146	725	7e-36
CLV2 [A. thaliana]	217	882	1e-50
FLS2 [A.thaliana]	235	848	7e-43
Xa21 [O. sativa]	255	844	1e-42
Xa21 [O. sativa]	341	850	1e-31
Xa21 [O. sativa]	418	847	3e-26
FLS2 [A.thaliana]	599	865	1e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	873	895	out -> in

Report for 2737.m00104

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)