Report for 2815.m00153

 > 2815.m00153, length: 423, copies: 1 

MAAATTTTVLATHDLLLLLLLLVAISFAGAAPLDPEQLVALRALGLRPHRLDPCDDAAGAVGVVAASCDAGVPFR

RVTSLVMANCSATTSVSAGALEALAPSLRALSFSDCPAAPPRLLPPEQLAAGLRAFSCVASLHRLSAVWLSHLEN

LTELTVADTPLATGSPSELAVVVSHMGHLTSLTLSNANLSGFLPHHWHCPNLTHLDLSGNRITGAIPDTLTLLSA

ITHLNLSSNDLNGNIPTSIGDLISLTTIDLSNNSISGRIPDTVSTLPELEVLNLGSNRLNGSIPQFLSEMRGLKE

LNLEGNDFDGMVPFTAKFVSRLRVFRAAGNPKLCYNRSVLSAEIAIGVAPCDKYGFPVMAPPATATARSERSADY

DDGAKDGDADEGADARGGPSAAVLGVAIGLSCLAFAVILLVCLCKVCR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam fs]	201	224	4e-05
LRR [Pfam ls]	201	224	0.00065
LRR [Pfam ls]	225	248	9.5
LRR [Pfam ls]	249	272	0.017
LRR [Pfam ls]	273	296	0.77

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	178	198	0.9
LRR [sensitive, ls]	178	198	18
LRR [sensitive, ls]	201	224	3.3e-05
LRR [sensitive, ls]	201	224	0.00065
LRR [sensitive, ls]	225	248	0.48
LRR [sensitive, ls]	225	248	9.5
LRR [sensitive, ls]	249	272	0.00084
LRR [sensitive, ls]	249	272	0.017
LRR [sensitive, ls]	273	296	0.039
LRR [sensitive, ls]	273	296	0.77
LRR [sensitive, ls]	297	319	1.2
LRR [sensitive, ls]	297	319	25

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	119	330	6e-16
Cf-9 [L. pimpinellifolium]	126	330	3e-11
CLV2 [A. thaliana]	132	330	2e-15
CLV2 [A. thaliana]	134	356	3e-15
FLS2 [A.thaliana]	139	313	9e-16
FLS2 [A.thaliana]	143	330	6e-17
Cf-9 [L. pimpinellifolium]	145	314	3e-12
FLS2 [A.thaliana]	145	322	2e-17
FLS2 [A.thaliana]	145	340	1e-16
FLS2 [A.thaliana]	145	313	7e-16
FLS2 [A.thaliana]	145	330	9e-13
Xa21 [O. sativa]	145	325	2e-19
Xa21 [O. sativa]	145	330	2e-16
Xa21 [O. sativa]	145	313	1e-10
Cf-9 [L. pimpinellifolium]	146	312	8e-16
Xa21 [O. sativa]	146	334	6e-18
FLS2 [A.thaliana]	147	330	3e-15
FLS2 [A.thaliana]	150	313	2e-16
FLS2 [A.thaliana]	150	330	3e-16
CLV2 [A. thaliana]	154	330	1e-10
CLV2 [A. thaliana]	168	313	5e-17
Cf-9 [L. pimpinellifolium]	169	313	2e-13
Xa21 [O. sativa]	175	330	3e-20
FLS2 [A.thaliana]	178	330	1e-15
CLV2 [A. thaliana]	179	351	6e-14
Cf-9 [L. pimpinellifolium]	205	307	1e-12
Cf-9 [L. pimpinellifolium]	218	320	2e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	9	31	in -> out
putative TM domain	396	418	out -> in

Report for 2815.m00153

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)