Report for 2900.m00132

 > 2900.m00132, length: 350, copies: 2 

MGWSNQLKKKLNFKFLNLILTLDISNNSLSGPLPLIFGAPMLTQLVLSINKINGTIPSYICELKYLEVLDLSDNF

LVGKLPRCSNGSEAKQELNMSPDSTQMQLSALILYNNDLSGKFPEFLQHCQELTLLHLPHNKFVGELPIWIAEKL

PRLSYLQLRYNLFSGSIPVQLTKLENLRYLDLAYNRISGSIPPTLGGLKAMIQGGDIPEEITSLVGLKNLNFSHN

HLTGNIPEKIGLLRYVESLDLSFNMISGEIPSSLSDMASLSYLNLSFNNLSGRIPSGNQLQTLGDPDFIYIGNYY

LCGPPLSRNCSGPEDSIQTSVWKTSAEWFHKSQRIQNKKGQGQASVSEGT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	65	87	6.6
LRR [Pfam ls]	103	126	2.9
LRR [Pfam ls]	152	175	6.8
LRR [Pfam fs]	176	199	2.1e-05
LRR [Pfam ls]	176	199	0.00033
LRR [Pfam ls]	216	239	0.35
LRR [Pfam ls]	240	263	0.81
LRR [Pfam ls]	264	286	0.36

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	18	40	1.3
LRR [sensitive, ls]	18	40	25
LRR [sensitive, ls]	41	64	1.2
LRR [sensitive, ls]	41	64	23
LRR [sensitive, ls]	65	87	0.34
LRR [sensitive, ls]	65	87	6.6
LRR [sensitive, ls]	103	126	0.15
LRR [sensitive, ls]	103	126	2.9
LRR [sensitive, ls]	127	151	0.74
LRR [sensitive, ls]	127	151	14
LRR [sensitive, ls]	152	175	0.35
LRR [sensitive, ls]	152	175	6.8
LRR [sensitive, ls]	176	199	1.7e-05
LRR [sensitive, ls]	176	199	0.00033
LRR [sensitive, ls]	216	239	0.018
LRR [sensitive, ls]	216	239	0.35
LRR [sensitive, ls]	240	263	0.041
LRR [sensitive, ls]	240	263	0.81
LRR [sensitive, ls]	264	286	0.018
LRR [sensitive, ls]	264	286	0.36

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	2	310	1e-27
FLS2 [A.thaliana]	3	281	3e-27
FLS2 [A.thaliana]	5	280	8e-28
Cf-9 [L. pimpinellifolium]	10	281	6e-17
FLS2 [A.thaliana]	12	303	2e-31
Xa21 [O. sativa]	12	232	1e-17
CLV2 [A. thaliana]	15	281	1e-34
Cf-9 [L. pimpinellifolium]	16	319	2e-29
Cf-9 [L. pimpinellifolium]	16	281	3e-17
CLV2 [A. thaliana]	16	303	1e-29
FLS2 [A.thaliana]	16	312	2e-30
Xa21 [O. sativa]	16	281	1e-26
Xa21 [O. sativa]	16	280	3e-22
FLS2 [A.thaliana]	19	314	2e-28
Xa21 [O. sativa]	19	303	2e-29
CLV2 [A. thaliana]	22	305	2e-22
CLV2 [A. thaliana]	22	191	1e-10
Xa21 [O. sativa]	42	270	1e-19
CLV2 [A. thaliana]	45	281	1e-18
FLS2 [A.thaliana]	51	288	3e-23
FLS2 [A.thaliana]	71	281	1e-21
CLV2 [A. thaliana]	86	306	4e-14
Xa21 [O. sativa]	152	280	2e-16
Xa21 [O. sativa]	180	281	3e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2900.m00132

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)