Report for 2958.m00029

 > 2958.m00029, length: 951, copies: 1 

MGWRMAVSRLLHGCVLVLLLAAAVVQAQRAATRTDPTEAAALNAVFAKLGQQAQSSWNLSGDPCTGRATDGSAID

DTSFNPAITCDCTFQNSTICRITKLKIYAVDASGQIPEELRNLTRLTDLNLGQNLLSGPLPSFIGELTNMQKMTF

GINSLSGPIPKELGNLTNLISLGLGSNHFNGSLPTELGNLINLQELYIDSAGLSGPLPSSLSKLTRMQILWASDN

NFTGQIPDYIGSWNLTDLRFQGNSFQGPIPAALSNLVQLSSLILRNCRISDNLVSLDFSKFASLSLLDFSYNQLS

GNFPPWASDKNLQFILPSGLACLQRNTPCFPGSPQSSSFAVNSGSNRFISGSDNLRYETDDVNLRAASYYVTGAP

TWGVSNVGKFMEAPNGSYIIYSSRQFQNTLDSELFQTSRMSPSSLRYYGIGLENGNYTVTLQFAEFGIEDTQSWK

SLGRRVFDIYVQGERKEKNFDIRKTAGDKSYTVVKKQYKVPVTKNFLEIHLFWAGKGTCCIPTQGYYGPTISALS

VIPADFTPTVGNTAQKNKSTSKTGVIVGVVVGVTVLGLVALVGIFMWRQKRRKLSLEQQELYSIVGRPNVFSYSE

LRSATENFSSSNRLGEGGYGAVYKGKLTDGRVVAVKQLSQTSHQGKKQFATEIETISRVQHRNLVKLYGCCLEGN

NPLLVYEYMENGSLDKALFGTEKLTIDWPARFEICLGIARGLAYLHEESSIRVVHRDIKASNVLIDANLNPKISD

FGLAKLYDDKKTHVSTKVAGTFGYLAPEYAMRGHMTEKVDVFAFGVVLLETLAGRPNYDDTLEEDKIYIFEWAWE

LYENNNPLGLVDPKLKEFNREELLRAIRVALLCTQGSPHQRPPMSRVASMLAGDVEVPDVLTKPSYITEWQIKGG

NTSFANSAVSGQSSSAPGSASEQQGSSLFLNSVIPEGRGQMVCETVSFAVQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	120	143	2.3
LRR [Pfam ls]	192	215	1.1
LRR [Pfam ls]	239	262	0.24
LRR [Pfam ls]	288	310	8.4
Ser/Thr pkinase [Pfam fs]	608	813	4.2e-58
Ser/Thr pkinase [Pfam ls]	608	876	8.3e-54

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	120	143	0.11
LRR [sensitive, ls]	120	143	2.3
LRR [sensitive, ls]	144	167	3.7
LRR [sensitive, ls]	144	167	75
LRR [sensitive, ls]	168	191	1.2
LRR [sensitive, ls]	168	191	24
LRR [sensitive, ls]	192	215	0.054
LRR [sensitive, ls]	192	215	1.1
LRR [sensitive, ls]	216	236	6.6
LRR [sensitive, ls]	216	236	130
LRR [sensitive, ls]	239	262	0.012
LRR [sensitive, ls]	239	262	0.24
LRR [sensitive, ls]	263	287	0.57
LRR [sensitive, ls]	263	287	11
LRR [sensitive, ls]	288	310	0.42
LRR [sensitive, ls]	288	310	8.4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	82	311	7e-18
FLS2 [A.thaliana]	83	304	3e-24
Cf-9 [L. pimpinellifolium]	92	301	3e-18
Cf-9 [L. pimpinellifolium]	92	343	2e-14
FLS2 [A.thaliana]	92	316	9e-21
Xa21 [O. sativa]	92	269	2e-20
Xa21 [O. sativa]	92	269	1e-18
Xa21 [O. sativa]	92	249	2e-13
FLS2 [A.thaliana]	94	304	8e-30
FLS2 [A.thaliana]	94	301	4e-23
FLS2 [A.thaliana]	94	304	5e-20
Xa21 [O. sativa]	94	304	4e-17
CLV2 [A. thaliana]	96	309	2e-14
Xa21 [O. sativa]	96	305	6e-26
Xa21 [O. sativa]	97	312	2e-23
FLS2 [A.thaliana]	100	304	3e-17
Cf-9 [L. pimpinellifolium]	108	356	1e-12
CLV2 [A. thaliana]	108	286	1e-18
CLV2 [A. thaliana]	108	304	9e-18
CLV2 [A. thaliana]	108	304	5e-16
FLS2 [A.thaliana]	108	315	2e-29
FLS2 [A.thaliana]	108	304	3e-28
FLS2 [A.thaliana]	108	304	8e-23
FLS2 [A.thaliana]	108	249	4e-16
Xa21 [O. sativa]	116	304	5e-20
CLV2 [A. thaliana]	121	305	4e-14
Xa21 [O. sativa]	527	690	6e-16
FLS2 [A.thaliana]	540	876	2e-41
Rpg1 [Hordeum vulgare]	574	877	1e-37
Pto [L. esculentum]	596	872	8e-59
Rpg1 [Hordeum vulgare]	596	872	2e-32

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	27	out -> in
putative TM domain	550	572	in -> out

Report for 2958.m00029

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)