Report for 2962.m00103

 > 2962.m00103, length: 1033, copies: 2 

MGKHTYDSSVADAIELDVPGFNYEVPVIVRLLAERTKTKLLPGAVTDATCELRLDCMRSGFASAQVASSVSKKAR

FLITTTSQNLKKKLNGLREFLILEKDSNISTSHGCFVEERTAMMDIGSSLTRSNGTVPPSWGRGDGDDDCCLWER

VKCSNITGRVSHLYFSNLYDSLEVLNAHGDSFWRFNTTVFSSFPELQFLDLSSIYPSSLNIDGLVGLKLPKLQHL

NLSYNWLQESILADLGELVSLEVLDASSNAMSGVVPTAVLKNLTNLKELNLSANGFSGSLPGSLLELPHLDPSGS

SLAGRTPINSSLEPVSLQVLNLNNNRMSGALPTERAFGYLRNLRELHLSSNNFTGNISTFLLSLPHIERLDLSGN

TFEGPIPITPSSNLSLSLKGLRFSQNNLSGKLSFFWLRNLTKLEEINLSGNINLAVDVNIPGWAPPFQLKQLALS

GCGLDKGIIAEPHFLRTQHHLQELDLSNNNLSGRMPNWLFTKEATLVNLNLGNNSLTGSLSPIWHPQTALQSIVI

STNRITGKLPANFSAIFPSLSTLDLSDNNFHGEIPMSLCSIKHMKDLSLSNNNFSGKMPTCVFTDFLELWTLSAS

NNQLGGLVFGGMKKLSIGFAMHLQNNKFEGTLPRNLSGALVIMDLHDNSLSGELDTSFWNLSKLQVLDLSGNHIT

GSIPQKICSLASIEILDLSNNNLSGSIPRCASASLSSLNLYGNSLSGNISDDLFNTSNLMYLDMRHNKLTGNLNW

LRHLDKIKTLSLGWNDFEGQITPNLCKLKCPRIIDFSHNKLSGSLPPCVGNISCESDTAAQNYSPLLLIYVIIEA

YIIVHDPIDFTFATKGGQYTYGYNFFDLMSGIDLSGNMLSGEIPWELGNLSHIKSLNLSNNFFTGQIPASFANMS

EIESLDLSHNELSGLIPWQLTKLSSLAVFSVAYNNLSGCIPNSGQFGTYGMDSYQGNSNLRSMSKGNICSPDSGA

GDLPSEGRDSMADDPVLYAVSAASFVLAFWGTVAFLFFHPLGRRAILATGNLVFWCGH

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	221	244	0.16
LRR [Pfam ls]	245	269	1.1
LRR [Pfam ls]	270	293	0.2
LRR [Pfam ls]	316	341	5.3
LRR [Pfam ls]	342	365	0.13
LRR [Pfam ls]	366	387	5.3
LRR [Pfam ls]	392	416	3.3
LRR [Pfam ls]	470	494	0.08
LRR [Pfam ls]	495	517	2.5
LRR [Pfam ls]	544	567	2.3
LRR [Pfam ls]	568	592	5.7
LRR [Pfam ls]	639	662	8.5
LRR [Pfam ls]	663	686	0.0026
LRR [Pfam ls]	687	707	0.55
LRR [Pfam ls]	709	732	1.7
LRR [Pfam ls]	733	755	8.5
LRR [Pfam ls]	853	876	7.7
LRR [Pfam ls]	877	900	0.014
LRR [Pfam ls]	901	924	0.098

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	171	194	2.6
LRR [sensitive, ls]	171	194	52
LRR [sensitive, ls]	221	244	0.0077
LRR [sensitive, ls]	221	244	0.16
LRR [sensitive, ls]	245	269	0.056
LRR [sensitive, ls]	245	269	1.1
LRR [sensitive, ls]	270	293	0.0098
LRR [sensitive, ls]	270	293	0.2
LRR [sensitive, ls]	316	341	0.26
LRR [sensitive, ls]	316	341	5.3
LRR [sensitive, ls]	342	365	0.0063
LRR [sensitive, ls]	342	365	0.13
LRR [sensitive, ls]	366	387	0.26
LRR [sensitive, ls]	366	387	5.3
LRR [sensitive, ls]	392	416	0.16
LRR [sensitive, ls]	392	416	3.3
LRR [sensitive, ls]	417	442	2.9
LRR [sensitive, ls]	417	442	58
LRR [sensitive, ls]	443	466	2.8
LRR [sensitive, ls]	443	466	56
LRR [sensitive, ls]	470	494	0.0039
LRR [sensitive, ls]	470	494	0.08
LRR [sensitive, ls]	495	517	0.13
LRR [sensitive, ls]	495	517	2.5
LRR [sensitive, ls]	519	539	1.5
LRR [sensitive, ls]	519	539	29
LRR [sensitive, ls]	544	567	0.11
LRR [sensitive, ls]	544	567	2.3
LRR [sensitive, ls]	568	592	0.28
LRR [sensitive, ls]	568	592	5.7
LRR [sensitive, ls]	593	616	1.2
LRR [sensitive, ls]	593	616	25
LRR [sensitive, ls]	639	662	0.42
LRR [sensitive, ls]	639	662	8.5
LRR [sensitive, ls]	663	686	0.00013
LRR [sensitive, ls]	663	686	0.0026
LRR [sensitive, ls]	687	707	0.027
LRR [sensitive, ls]	687	707	0.55
LRR [sensitive, ls]	709	732	0.084
LRR [sensitive, ls]	709	732	1.7
LRR [sensitive, ls]	733	755	0.42
LRR [sensitive, ls]	733	755	8.5
LRR [sensitive, ls]	756	779	0.58
LRR [sensitive, ls]	756	779	12
LRR [sensitive, ls]	780	803	0.65
LRR [sensitive, ls]	780	803	13
LRR [sensitive, ls]	853	876	0.38
LRR [sensitive, ls]	853	876	7.7
LRR [sensitive, ls]	877	900	0.00072
LRR [sensitive, ls]	877	900	0.014
LRR [sensitive, ls]	901	924	0.0048
LRR [sensitive, ls]	901	924	0.098
LRR [sensitive, ls]	925	947	5.6
LRR [sensitive, ls]	925	947	110

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	96	737	5e-47
CLV2 [A. thaliana]	145	793	5e-43
Cf-9 [L. pimpinellifolium]	179	704	4e-34
FLS2 [A.thaliana]	201	719	5e-49
Xa21 [O. sativa]	201	719	4e-30
CLV2 [A. thaliana]	218	559	2e-21
FLS2 [A.thaliana]	240	965	2e-73
FLS2 [A.thaliana]	241	943	6e-63
Cf-9 [L. pimpinellifolium]	265	969	1e-73
CLV2 [A. thaliana]	270	1024	1e-62
Cf-9 [L. pimpinellifolium]	320	944	3e-44
FLS2 [A.thaliana]	320	959	6e-52
Xa21 [O. sativa]	345	960	3e-48
FLS2 [A.thaliana]	487	941	2e-41
CLV2 [A. thaliana]	493	941	2e-35
Cf-9 [L. pimpinellifolium]	548	947	9e-26
Xa21 [O. sativa]	610	943	6e-26

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	991	1013	out -> in

Report for 2962.m00103

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)