Report for 3028.m00170

 > 3028.m00170, length: 905, copies: 1 

MAAGGGGGGSAAARPALDCVWFPVKFSSRKTSGFNLLIKNAGKITDAACISSERDALLAFKAGFADPAGGALRFW

QGQDCCAWSGVSCSKKIGSVVSLDIGHYDLTFRGEINSSLAVLTHLVYLNLSGNDFGGVAIPDFIGSFEKLRYLD

LSHAGFGGTVPPRLGNLSMLSHLDLSSPSHTVTVKSFNWVSRLTSLVYLDLSWLYLAASSDWLQATNTLPLLKVL

CLNHAFLPATDLNALSHTNFTAIRVLDLKSNNFSSRMPDWISKLSSLAYLDLSSCELSGSLPRNLGNLTSLSFFQ

LRANNLEGEIPGSMSRLCNLRHIDLSGNHFSGDITRLANTLFPCMNQLKILDLALNNLTGSLSGWVRHIASVTTL

DLSENSLSGRVSDDIGKLSNLTYLDLSANSFQGTLSELHFANLSRLDMLILESIYVKIVTEADWVPPFQLRVLVL

YGCQVGPHFPAWLKSQAKIEMIELSRAQIKSKLPDWLWNFSSTISALDVSGNMINGKLPKSLKHMKALELLDMSS

NQLEGCIPDLPSSVKVLDLSSNHLYGPLPQRLGAKEIYYLSLKDNFLSGSIPTYLCEMVWMEQVLLSLNNFSGVL

PNCWRKGSALRVIDFSNNNIHGEISSTMGHLTSLGSLLLHRNKLSGPLPTSLKLCNRLIFLDLSENNLSGTIPTW

IGDSLQSLILLSLRSNNFSGKIPELLSQLHALQILDIADNNLSGPVPKSLGNLAAMQLGRHMIQQQFSTISDIHF

MVYGAGGAVLYRLYAYLYLNSLLAGKLQYNGTAFYIDLSGNQLAGEIPIEIGFLSGLTGLNLSGNHIRGSIPEEL

GNLRSLEVLDLSRNDLSGPIPQCFLSLSGLSHLNLSYNDLSGAIPFGNELATFAESTYFGNAHTTVKKLFVPQKE

ASTKL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	120	144	1.3
LRR [Pfam ls]	145	168	0.059
LRR [Pfam ls]	247	270	2.9
LRR [Pfam ls]	271	294	0.013
LRR [Pfam ls]	319	346	0.052
LRR [Pfam ls]	371	394	0.34
LRR [Pfam ls]	395	419	0.02
LRR [Pfam ls]	493	516	4.4
LRR [Pfam ls]	609	632	1
LRR [Pfam ls]	657	681	0.78
LRR [Pfam ls]	682	705	1.2
LRR [Pfam ls]	706	729	0.13
LRR [Pfam ls]	806	829	0.0048
LRR [Pfam ls]	830	853	0.012
LRR [Pfam ls]	854	876	6.5

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	94	119	2.4
LRR [sensitive, ls]	94	119	56
LRR [sensitive, ls]	120	144	0.057
LRR [sensitive, ls]	120	144	1.3
LRR [sensitive, ls]	145	168	0.0025
LRR [sensitive, ls]	145	168	0.059
LRR [sensitive, ls]	247	270	0.12
LRR [sensitive, ls]	247	270	2.9
LRR [sensitive, ls]	271	294	0.00056
LRR [sensitive, ls]	271	294	0.013
LRR [sensitive, ls]	295	315	2.5
LRR [sensitive, ls]	295	315	57
LRR [sensitive, ls]	319	346	0.0022
LRR [sensitive, ls]	319	346	0.052
LRR [sensitive, ls]	347	370	1.2
LRR [sensitive, ls]	347	370	29
LRR [sensitive, ls]	371	394	0.014
LRR [sensitive, ls]	371	394	0.34
LRR [sensitive, ls]	395	419	0.00087
LRR [sensitive, ls]	395	419	0.02
LRR [sensitive, ls]	444	467	1.1
LRR [sensitive, ls]	444	467	26
LRR [sensitive, ls]	468	491	0.9
LRR [sensitive, ls]	468	491	21
LRR [sensitive, ls]	493	516	0.19
LRR [sensitive, ls]	493	516	4.4
LRR [sensitive, ls]	517	537	0.68
LRR [sensitive, ls]	517	537	16
LRR [sensitive, ls]	538	558	1.3
LRR [sensitive, ls]	538	558	31
LRR [sensitive, ls]	561	584	1.4
LRR [sensitive, ls]	561	584	32
LRR [sensitive, ls]	609	632	0.043
LRR [sensitive, ls]	609	632	1
LRR [sensitive, ls]	633	656	0.78
LRR [sensitive, ls]	633	656	18
LRR [sensitive, ls]	657	681	0.033
LRR [sensitive, ls]	657	681	0.78
LRR [sensitive, ls]	682	705	0.05
LRR [sensitive, ls]	682	705	1.2
LRR [sensitive, ls]	706	729	0.0054
LRR [sensitive, ls]	706	729	0.13
LRR [sensitive, ls]	782	805	1.2
LRR [sensitive, ls]	782	805	28
LRR [sensitive, ls]	806	829	0.00021
LRR [sensitive, ls]	806	829	0.0048
LRR [sensitive, ls]	830	853	0.00051
LRR [sensitive, ls]	830	853	0.012
LRR [sensitive, ls]	854	876	0.28
LRR [sensitive, ls]	854	876	6.5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	53	699	1e-40
FLS2 [A.thaliana]	53	886	3e-77
Cf-9 [L. pimpinellifolium]	80	886	1e-68
FLS2 [A.thaliana]	109	769	8e-57
CLV2 [A. thaliana]	121	576	3e-38
Xa21 [O. sativa]	129	421	7e-15
Xa21 [O. sativa]	244	722	1e-53
Xa21 [O. sativa]	251	888	2e-49
CLV2 [A. thaliana]	275	878	2e-48
CLV2 [A. thaliana]	344	873	2e-42
Xa21 [O. sativa]	536	870	7e-36

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3028.m00170

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)