Report for 3181.m00139

 > 3181.m00139, length: 394, copies: 2 

MALLRWKSTLRISSVHMSSWKNTTSLCNWTGIMCSRSVIRHGRRHRLPWPVVTNISLPASGIHGQLRELDFSSLP

YLTYIDLSKNSLSGPIPSNINSLSALVHLELQLNLLTGRIPDEIGELRSLTTLSLSFNNLTGHIPASLGNLTMVT

TFFVHQNMISSFIPKEIGLLANLQSLSLSNNTLTGEIPRTLANLTNLATLQLYGNELSGPIPQKLCMLTKIQYLE

LSGNKLTGELPSCLSNLTKMKELYLHQNQITGSIPKEIGMLANLQLLSLGNNTFSGEIPTTLANLTNLATLYLWG

NELSGPIPQKLCMLTKMQYLGLNSNKLTSEIPACLSDLTKMEKLYLYQNQITGSIPKEIGMLANLHLLNVGNNAF

SGEIPITLSNLTNLATLYL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	76	99	0.65
LRR [Pfam ls]	124	147	0.0011
LRR [Pfam ls]	172	195	0.001
LRR [Pfam ls]	196	219	2.9
LRR [Pfam ls]	220	243	0.0011
LRR [Pfam ls]	244	267	2.2
LRR [Pfam ls]	268	291	0.058
LRR [Pfam ls]	316	339	0.89
LRR [Pfam ls]	340	363	2
LRR [Pfam ls]	364	387	0.23

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	76	99	0.028
LRR [sensitive, ls]	76	99	0.65
LRR [sensitive, ls]	100	123	0.26
LRR [sensitive, ls]	100	123	6.1
LRR [sensitive, ls]	124	147	4.7e-05
LRR [sensitive, ls]	124	147	0.0011
LRR [sensitive, ls]	172	195	4.5e-05
LRR [sensitive, ls]	172	195	0.001
LRR [sensitive, ls]	196	219	0.13
LRR [sensitive, ls]	196	219	2.9
LRR [sensitive, ls]	220	243	4.7e-05
LRR [sensitive, ls]	220	243	0.0011
LRR [sensitive, ls]	244	267	0.094
LRR [sensitive, ls]	244	267	2.2
LRR [sensitive, ls]	268	291	0.0025
LRR [sensitive, ls]	268	291	0.058
LRR [sensitive, ls]	292	315	0.27
LRR [sensitive, ls]	292	315	6.3
LRR [sensitive, ls]	316	339	0.038
LRR [sensitive, ls]	316	339	0.89
LRR [sensitive, ls]	340	363	0.087
LRR [sensitive, ls]	340	363	2
LRR [sensitive, ls]	364	387	0.0099
LRR [sensitive, ls]	364	387	0.23

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	1	394	3e-53
CLV2 [A. thaliana]	2	389	4e-38
FLS2 [A.thaliana]	17	392	2e-63
Cf-9 [L. pimpinellifolium]	19	394	9e-34
Cf-9 [L. pimpinellifolium]	52	394	2e-33
FLS2 [A.thaliana]	52	394	2e-57
FLS2 [A.thaliana]	52	380	6e-47
Xa21 [O. sativa]	52	394	1e-44
Xa21 [O. sativa]	52	309	6e-32
Cf-9 [L. pimpinellifolium]	55	394	2e-37
FLS2 [A.thaliana]	55	278	1e-30
FLS2 [A.thaliana]	57	309	2e-35
Cf-9 [L. pimpinellifolium]	68	394	6e-36
Cf-9 [L. pimpinellifolium]	70	216	1e-12
CLV2 [A. thaliana]	71	394	4e-32
CLV2 [A. thaliana]	77	379	7e-37
FLS2 [A.thaliana]	77	394	2e-48
FLS2 [A.thaliana]	77	394	3e-46
Cf-9 [L. pimpinellifolium]	82	357	3e-30
CLV2 [A. thaliana]	180	394	1e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3181.m00139

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)