Report for 3379.m00101

 > 3379.m00101, length: 1110, copies: 2 

MDILIPLLLSSIYVSSSAAAAETDAAALLRFKAFVHKDPRGVLSSWVDPGPCRWRGVTCNGDGRVTELDLAAGGL

AGRAELAALSGLDTLCRLNLSGNGELHVDAGDLVKLPRALLQLDLSDGGLAGRLPDGFLACYPNLTDVSLARNNL

TGELPGMLLASNIRSFDVSGNNMSGDISGVSLPATLAVLDLSGNRFTGAIPPSLSGCAGLTTLNLSYNGLAGAIP

EGIGAIAGLEVLDVSWNHLTGAIPPGLGRNACASLRVLRVSSNNISGSIPESLSSCHALRLLDVANNNVSGGIPA

AVLGNLTAVESLLLSNNFISGSLPDTIAHCKNLRVADLSSNKISGALPAELCSPGAALEELRLPDNLVAGTIPPG

LSNCSRLRVIDFSINYLRGPIPPELGRLRALEKLVMWFNGLDGRIPADLGQCRNLRTLILNNNFIGGDIPVELFN

CTGLEWVSLTSNQITGTIRPEFGRLSRLAVLQLANNSLAGEIPRELGNCSSLMWLDLNSNRLTGEIPRRLGRQLG

STPLSGILSGNTLAFVRNVGNSCKGVGGLLEFAGIRPERLLQVPTLKSCDFTRLYSGAAVSGWTRYQTLEYLDLS

YNSLDGEIPEELGDMVVLQVLDLARNNLTGEIPASLGRLRNLGVFDVSRNRLQGGIPDSFSNLSFLVQIDISDNN

LSGEIPQRGQLSTLPASQYAGNPGLCGMPLEPCGDRLPTATMSGLAAAASTDPPPRRAVATWANGVILAVLVSAG

LACAAAIWAVAARARRREVRSAMMLSSLQDGTRTATTWKLGKAEKEALSINVATFQRQLRKLTFTQLIEATNGFS

TASLIGSGGFGEVFKATLKDGSCVAIKKLIHLSYQGDREFMAEMETLGKIKHKNLVPLLGYCKIGEERLLVYEFM

SHGSLEDTLHGDGGRSASPAMSWEQRKKVARGAARGLCFLHYNCIPHIIHRDMKSSNVLLDGDMEARVADFGMAR

LISALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVLLELLTGRRPTDKDDFGDTNLVGWVKMKVGDG

AGKEVLDPELVVEGADADEMARFMDMALQCVDDFPSKRPNMLQVVAMLRELDAPPPATAI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	185	208	0.026
LRR [Pfam ls]	209	232	3.8
LRR [Pfam ls]	233	257	0.55
LRR [Pfam ls]	259	282	0.02
LRR [Pfam ls]	283	307	0.014
LRR [Pfam ls]	308	331	1.6
LRR [Pfam ls]	357	380	1.9
LRR [Pfam ls]	381	404	3.9
LRR [Pfam ls]	429	452	0.064
LRR [Pfam ls]	453	476	0.57
LRR [Pfam ls]	477	500	1.2
LRR [Pfam ls]	501	525	1.5
LRR [Pfam ls]	593	616	0.02
LRR [Pfam ls]	617	640	0.044
LRR [Pfam ls]	641	664	0.088
Ser/Thr pkinase [Pfam fs]	824	1030	2.1e-48
Ser/Thr pkinase [Pfam ls]	824	1100	5.9e-45

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	89	112	1.7
LRR [sensitive, ls]	89	112	39
LRR [sensitive, ls]	114	138	1.2
LRR [sensitive, ls]	114	138	29
LRR [sensitive, ls]	139	160	0.94
LRR [sensitive, ls]	139	160	22
LRR [sensitive, ls]	162	183	0.57
LRR [sensitive, ls]	162	183	13
LRR [sensitive, ls]	185	208	0.0011
LRR [sensitive, ls]	185	208	0.026
LRR [sensitive, ls]	209	232	0.16
LRR [sensitive, ls]	209	232	3.8
LRR [sensitive, ls]	233	257	0.024
LRR [sensitive, ls]	233	257	0.55
LRR [sensitive, ls]	259	282	0.00086
LRR [sensitive, ls]	259	282	0.02
LRR [sensitive, ls]	283	307	0.00061
LRR [sensitive, ls]	283	307	0.014
LRR [sensitive, ls]	308	331	0.069
LRR [sensitive, ls]	308	331	1.6
LRR [sensitive, ls]	332	355	0.26
LRR [sensitive, ls]	332	355	6.2
LRR [sensitive, ls]	357	380	0.083
LRR [sensitive, ls]	357	380	1.9
LRR [sensitive, ls]	381	404	0.17
LRR [sensitive, ls]	381	404	3.9
LRR [sensitive, ls]	405	428	1.3
LRR [sensitive, ls]	405	428	30
LRR [sensitive, ls]	429	452	0.0027
LRR [sensitive, ls]	429	452	0.064
LRR [sensitive, ls]	453	476	0.025
LRR [sensitive, ls]	453	476	0.57
LRR [sensitive, ls]	477	500	0.05
LRR [sensitive, ls]	477	500	1.2
LRR [sensitive, ls]	501	525	0.064
LRR [sensitive, ls]	501	525	1.5
LRR [sensitive, ls]	593	616	0.00086
LRR [sensitive, ls]	593	616	0.02
LRR [sensitive, ls]	617	640	0.0019
LRR [sensitive, ls]	617	640	0.044
LRR [sensitive, ls]	641	664	0.0038
LRR [sensitive, ls]	641	664	0.088
LRR [sensitive, ls]	665	688	0.29
LRR [sensitive, ls]	665	688	6.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	3	1101	1e-131
Xa21 [O. sativa]	3	493	1e-49
CLV2 [A. thaliana]	24	701	1e-55
Cf-9 [L. pimpinellifolium]	52	730	7e-55
Xa21 [O. sativa]	162	910	2e-79
Pto [L. esculentum]	792	1095	2e-46
Rpg1 [Hordeum vulgare]	810	1101	2e-38
Rpg1 [Hordeum vulgare]	821	1102	4e-30

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End
putative coiled-coil	792	812

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	740	762	out -> in

Report for 3379.m00101

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)