Report for 3395.m00178

 > 3395.m00178, length: 1109, copies: 2 

MSPLLLGFLCLLLFAGQVAVVASDDDREVLVELKRFLQANNRFNRGEYDRWPESDASPCRWAGVTCDGRGRVTAL

DLSGSAISGAAFGNFSRLTALTWLDLSDNGIGGELPAGDLAQCRGLVHLNLSHNLIAGGLDVSGLTKLRTLDVSG

NRFVGGAAASFVPAACGDLAVLNVSGNGFTGDITGLFDGCPKLEYIDLSTNNFTGELWPGIARFTQFNVAENNLT

GGVPAATFPGGCKLRSLDLSANHFAGEFPDSIASCSNLTYLSLWGNGFAGKISAGIGELAGLETLILGKNRFDRR

IPPELTNCTSLQFLDMSTNAFGGDMQGILGEFVTLKYLVLHHNNYTGGIVSSGVLRLPLLARLDLSFNQFSGELP

LEVADMKSLKYLMLPANSFSGGIPPEYGRLAELQALDLSYNGLTGRIPASIGNLTSLLWLMLAGNQLSGEIPPEI

GNCSSLLWLNLADNRLTGRIPPEMAEIGRNPAPTFEKNRKDVSVLAGSGECQAMRRWIPATYPPFNFVYTVMTRE

NCRSIWDRLLKGYGIIPICTNSSSPVRSNTISGYVQLSGNKLSGEIPSQIGAMRNLSLLHLDNNQLTGRLPPAIS

HLPLVVLNVSNNSISGGIPPEIGHILCLEILDLAYNNFSGELPASLGNLTGLNKFNVSYNPLLSGDVPTTGQLGT

FDELSFLGDPLITLQDRGPRRQRAPQAAIRGRGMSPRTIALWFVFSLIIAFIAGTVVFIMANLRARFPVDQDPDP

ESLSCENPKCGGGGGGGGKCGAFHMSATSSPPSGCSSSCVTGCSSSSEGVKVFRLDKTAFTYRDIVAATSGFSDD

RVVGRGGYGVVYRGVLPDGRDVAVKKLARLRDCGGGGGGEDSGEREFRAEMEVLADRMGFTWPHPNLVTLYGWCL

AGSAKILVYEYLDGGNLESLIGDHAAFGRRRRLDAAIGVARALVFLHHECRPAVVHRDVKASNVLLGRDGGVKVT

DFGLARVVRPGDTHVSTMVAGTVGYVAPEYGQTWRATTKGDVYSYGVLLMELATGRRAVDGGEEECLVEWSRRMA

QEGWPAREAAASSGAVLWDMLMLGMRCTADSPQERPDMPDVLAALLDIAGSGGGGDPNS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	71	94	5
LRR [Pfam ls]	95	119	0.048
LRR [Pfam ls]	120	141	2.9
LRR [Pfam ls]	168	191	2.8
LRR [Pfam ls]	192	218	5.5
LRR [Pfam ls]	238	261	1.5
LRR [Pfam ls]	359	382	5.2
LRR [Pfam ls]	407	430	0.0072
LRR [Pfam ls]	431	454	0.41
LRR [Pfam ls]	455	475	4.9
LRR [Pfam ls]	580	603	0.0032
LRR [Pfam ls]	627	650	0.016
Ser/Thr pkinase [Pfam fs]	822	1030	2.7e-50
Ser/Thr pkinase [Pfam ls]	822	1097	3.5e-46

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	71	94	0.24
LRR [sensitive, ls]	71	94	5
LRR [sensitive, ls]	95	119	0.0023
LRR [sensitive, ls]	95	119	0.048
LRR [sensitive, ls]	120	141	0.14
LRR [sensitive, ls]	120	141	2.9
LRR [sensitive, ls]	142	165	1.1
LRR [sensitive, ls]	142	165	22
LRR [sensitive, ls]	168	191	0.14
LRR [sensitive, ls]	168	191	2.8
LRR [sensitive, ls]	192	218	0.27
LRR [sensitive, ls]	192	218	5.5
LRR [sensitive, ls]	238	261	0.074
LRR [sensitive, ls]	238	261	1.5
LRR [sensitive, ls]	262	285	0.36
LRR [sensitive, ls]	262	285	7.5
LRR [sensitive, ls]	286	309	0.38
LRR [sensitive, ls]	286	309	7.8
LRR [sensitive, ls]	310	333	2.2
LRR [sensitive, ls]	310	333	46
LRR [sensitive, ls]	334	358	4.1
LRR [sensitive, ls]	334	358	85
LRR [sensitive, ls]	359	382	0.25
LRR [sensitive, ls]	359	382	5.2
LRR [sensitive, ls]	383	406	0.96
LRR [sensitive, ls]	383	406	20
LRR [sensitive, ls]	407	430	0.00035
LRR [sensitive, ls]	407	430	0.0072
LRR [sensitive, ls]	431	454	0.02
LRR [sensitive, ls]	431	454	0.41
LRR [sensitive, ls]	455	475	0.24
LRR [sensitive, ls]	455	475	4.9
LRR [sensitive, ls]	580	603	0.00015
LRR [sensitive, ls]	580	603	0.0032
LRR [sensitive, ls]	604	626	2
LRR [sensitive, ls]	604	626	41
LRR [sensitive, ls]	627	650	0.00079
LRR [sensitive, ls]	627	650	0.016

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	4	672	8e-38
CLV2 [A. thaliana]	56	741	1e-55
FLS2 [A.thaliana]	59	672	2e-63
Xa21 [O. sativa]	62	668	1e-47
FLS2 [A.thaliana]	72	684	2e-62
FLS2 [A.thaliana]	72	498	2e-33
Cf-9 [L. pimpinellifolium]	75	349	2e-13
Cf-9 [L. pimpinellifolium]	77	399	1e-16
Cf-9 [L. pimpinellifolium]	168	643	3e-36
Xa21 [O. sativa]	169	918	2e-56
FLS2 [A.thaliana]	549	686	1e-11
Pto [L. esculentum]	787	1092	3e-36
Rpg1 [Hordeum vulgare]	790	1098	5e-26
FLS2 [A.thaliana]	810	1100	4e-30
Rpg1 [Hordeum vulgare]	810	1106	1e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	714	736	out -> in

Report for 3395.m00178

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)