Report for 3510.m00150

 > 3510.m00150, length: 1010, copies: 2 

MGLHIWCWLVVLFSLAPLCCSLSADGLALLDLAKTLILPSSISSNWSADDATPCTWKGVDCDEMSNVVSLNLSYS

GLSGSLGPQIGLMKHLKVIDLSGNGISGPMPSSIGNCTKLEVLHLLRNRLSGILPDTLSNIEALRVFDLSRNSFT

GKVNFRFENCKLEEFILSFNYLRGEIPVWIGNCSSLTQLAFVNNSITGQIPSSIGLLRNLSYLVLSQNSLSGTIP

PEIGNCQLLIWLHLDANQLEGTIPKELANLRNLQKLYLFENCLTGEFPEDIWGIQSLLSVDIYKNNFTGQLPIVL

AEMKQLQQITLFNNSFTGVIPQGLGVNSSLSVIDFINNSFVGTIPPKICSGGRLEVLNLGSNLLNGSIPSGIADC

PTLRRVILNQNNLIGSIPQFVNCSSLNYIDLSYNLLSGDIPASLSKCINVTFVNWSWNKLAGLIPSEIGNLGNLS

SLNLSGNRLYGELPVEISGCSKLYKLDLSYNSLNGSALTTVSSLKFLSQLRLQENKFSGGIPDSLSQLDMLIELQ

LGGNILGGSIPSSLGKLVKLGIALNLSRNGLVGDIPPLGNLVELQSLDLSFNNLTGGLASLGNLQFLYFLNVSYN

MFSGPVPKNLVRFLNSTPSSFSGNADLCISCHENDSSCTGSNVLRPCGSMSKKSALTPLKVAMIVLGSVFAGAFL

ILCVLLKYNFKPKINSDLGILFQGSSSKLNEAVEVTENFNNKYIIGSGAHGIVYKAVLRSGEVYAVKKLVHAAHK

GSNASMIRELQTLGQIRHRNLIRLNEFLFKHEYGLILYDFMENGSLYDVLHGTEPTPTLDWSIRYSIALGTAHGL

AYLHNDCHPAIIHRDIKPKNILLDNDMVPHISDFGIAKLMDQYPAALQTTGIVGTIGYMAPEMAFSTKATTEFDV

YSYGVVLLELITRKMAVDSSFPGNMDIVSWVSSKLNETNQIETICDPALITEVYGTHEMEEVRKLLSLALRCTAK

EASQRPSMAVVVKELTDARHVAGSYSKQNSGPSNS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	66	89	5.1
LRR [Pfam ls]	90	113	0.008
LRR [Pfam ls]	114	137	2
LRR [Pfam ls]	161	184	3.9
LRR [Pfam ls]	209	232	0.039
LRR [Pfam ls]	233	256	3.3
LRR [Pfam ls]	257	280	1
LRR [Pfam ls]	353	376	0.24
LRR [Pfam ls]	377	399	6.4
LRR [Pfam ls]	400	423	0.46
LRR [Pfam ls]	448	471	0.11
LRR [Pfam ls]	472	495	5.2
LRR [Pfam ls]	568	590	0.0063
Ser/Thr pkinase [Pfam fs]	714	913	1.1e-49
Ser/Thr pkinase [Pfam ls]	714	991	1.3e-47

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	66	89	0.19
LRR [sensitive, ls]	66	89	5.1
LRR [sensitive, ls]	90	113	0.0003
LRR [sensitive, ls]	90	113	0.008
LRR [sensitive, ls]	114	137	0.074
LRR [sensitive, ls]	114	137	2
LRR [sensitive, ls]	138	158	2.5
LRR [sensitive, ls]	138	158	66
LRR [sensitive, ls]	161	184	0.15
LRR [sensitive, ls]	161	184	3.9
LRR [sensitive, ls]	185	208	0.4
LRR [sensitive, ls]	185	208	11
LRR [sensitive, ls]	209	232	0.0015
LRR [sensitive, ls]	209	232	0.039
LRR [sensitive, ls]	233	256	0.13
LRR [sensitive, ls]	233	256	3.3
LRR [sensitive, ls]	257	280	0.038
LRR [sensitive, ls]	257	280	1
LRR [sensitive, ls]	281	304	0.39
LRR [sensitive, ls]	281	304	10
LRR [sensitive, ls]	305	328	0.28
LRR [sensitive, ls]	305	328	7.3
LRR [sensitive, ls]	329	352	3.7
LRR [sensitive, ls]	329	352	99
LRR [sensitive, ls]	353	376	0.0089
LRR [sensitive, ls]	353	376	0.24
LRR [sensitive, ls]	377	399	0.24
LRR [sensitive, ls]	377	399	6.4
LRR [sensitive, ls]	400	423	0.017
LRR [sensitive, ls]	400	423	0.46
LRR [sensitive, ls]	448	471	0.0043
LRR [sensitive, ls]	448	471	0.11
LRR [sensitive, ls]	472	495	0.2
LRR [sensitive, ls]	472	495	5.2
LRR [sensitive, ls]	496	519	0.29
LRR [sensitive, ls]	496	519	7.7
LRR [sensitive, ls]	520	543	0.29
LRR [sensitive, ls]	520	543	7.8
LRR [sensitive, ls]	568	590	0.00024
LRR [sensitive, ls]	568	590	0.0063
LRR [sensitive, ls]	591	615	1.1
LRR [sensitive, ls]	591	615	30

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	23	801	2e-87
CLV2 [A. thaliana]	31	643	3e-61
Cf-9 [L. pimpinellifolium]	39	590	1e-57
FLS2 [A.thaliana]	39	634	4e-85
FLS2 [A.thaliana]	59	1005	1e-127
Cf-9 [L. pimpinellifolium]	101	599	1e-46
Cf-9 [L. pimpinellifolium]	300	610	2e-17
Pto [L. esculentum]	682	990	9e-45
Rpg1 [Hordeum vulgare]	691	992	2e-38
Rpg1 [Hordeum vulgare]	710	990	2e-25

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	659	681	out -> in

Report for 3510.m00150

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)