Report for 3510.m00152

 > 3510.m00152, length: 1112, copies: 2 

MRLVVWHWFFFFFFTSVSSSWSLTSDGLALLSLSRDLILPHSISSTWKASDTTPCNWDGVSCNKKNSVVSLDLSS

SGVSGSLGPQIGLMKSLQVLSLSNNSISGSIPQELGNCSMLDQLDLSSNSFSGEIPASLGDIKKLSSLSLYSNSL

TGEIPEGLFKNQFLEQVYLHYNKLSGSIPLTVGEMTSLRYLWLHGNKLSGVLPDSIGNCTKLEELYLLDNQLSGS

LPKTLSYIKGLKIFDITANSFTGEITFSFEDCKLEVFILSFNQISNEIPSWLGNCSSLTQLAFVNNNISGQIPSS

LGLLRNLSQLLLSENSLSGPIPPEIGNCQLLVWLELDANQLNGTVPKELANLRKLEKLFLFENRLIGEFPEDIWS

IKSLQSVLIYENSFTGRLPPVLAELKFLKNITLFNNFFTGVIPPDLGVNSRLTQIDFTNNSFVGGIPPNICSGKR

LRILDLGLNLLNGSIPSNVMDCPSLERFILQNNNLSGPIPQFRNCANLSYIDLSHNSLSGNIPASLGRCVNITMI

KWSENKLVGPIPSEIRDLVNLRVLNLSQNSLQGVLPVQISSCSKLYLLDLSFNSLNGSALTTVSNLKFLSQLRLQ

ENKFSGGIPDSLSQLDMLIELQLGGNVLGGSIPSSLGRLVKLGIALNICSNGLVGGIPPLLSNLVELQSLDLSLN

GLTGDLDMLGNLQLLHVLNVSYNRFSGPVPENLLNFLVSSPSSFNGNPDLCISCHTNGSYCKGSNVLKPCGETKK

LHKHVKIAVIVIGSLFVGAVSILILSCILLKFYHPKTKNLESVSTLFEGSSSKLNEVIEATENFDDKYIIGTGAH

GTVYKATLRSGEVYAVKKLAISAQKGSYKSMIRELKTLGKIKHRNLIKLKEFWLRSEYGFMLYVYMEQGSLQDVL

HGIQPPPSLDWSVRYTIALGTAHGLAYLHDDCQPAIIHRDIKPSNILLNGDMVPHIADFGIAKLMDQSSSAPQTT

GVIGTFGYMAPELAFSTRSSIESDVYSYGVILLELLTKKQVVDPSFPDNMDIVGWVTATLNGTDQIELVCDSTLM

EEVYGTVEIEEVSKVLSLALRCAAKEASRRPPMADVVKELTDVRKSAGKLSKPEKTASRSSS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	91	114	0.0017
LRR [Pfam ls]	115	138	5.3
LRR [Pfam ls]	139	162	0.85
LRR [Pfam ls]	187	210	0.0031
LRR [Pfam ls]	258	281	0.82
LRR [Pfam ls]	306	329	2.3
LRR [Pfam ls]	378	401	2.7
LRR [Pfam ls]	474	496	1.2
LRR [Pfam ls]	497	520	0.11
LRR [Pfam ls]	545	568	0.061
LRR [Pfam ls]	569	592	5.2
LRR [Pfam ls]	666	688	4.7
Ser/Thr pkinase [Pfam fs]	814	1013	7.2e-50
Ser/Thr pkinase [Pfam ls]	814	1087	5e-47

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	67	90	0.48
LRR [sensitive, ls]	67	90	13
LRR [sensitive, ls]	91	114	6.2e-05
LRR [sensitive, ls]	91	114	0.0017
LRR [sensitive, ls]	115	138	0.2
LRR [sensitive, ls]	115	138	5.3
LRR [sensitive, ls]	139	162	0.032
LRR [sensitive, ls]	139	162	0.85
LRR [sensitive, ls]	163	186	0.26
LRR [sensitive, ls]	163	186	7
LRR [sensitive, ls]	187	210	0.00012
LRR [sensitive, ls]	187	210	0.0031
LRR [sensitive, ls]	211	234	0.29
LRR [sensitive, ls]	211	234	7.8
LRR [sensitive, ls]	258	281	0.031
LRR [sensitive, ls]	258	281	0.82
LRR [sensitive, ls]	282	305	0.27
LRR [sensitive, ls]	282	305	7.2
LRR [sensitive, ls]	306	329	0.085
LRR [sensitive, ls]	306	329	2.3
LRR [sensitive, ls]	330	353	0.29
LRR [sensitive, ls]	330	353	7.7
LRR [sensitive, ls]	354	377	0.47
LRR [sensitive, ls]	354	377	12
LRR [sensitive, ls]	378	401	0.1
LRR [sensitive, ls]	378	401	2.7
LRR [sensitive, ls]	402	425	0.39
LRR [sensitive, ls]	402	425	10
LRR [sensitive, ls]	426	449	0.38
LRR [sensitive, ls]	426	449	10
LRR [sensitive, ls]	450	473	0.4
LRR [sensitive, ls]	450	473	11
LRR [sensitive, ls]	474	496	0.046
LRR [sensitive, ls]	474	496	1.2
LRR [sensitive, ls]	497	520	0.0041
LRR [sensitive, ls]	497	520	0.11
LRR [sensitive, ls]	545	568	0.0023
LRR [sensitive, ls]	545	568	0.061
LRR [sensitive, ls]	569	592	0.2
LRR [sensitive, ls]	569	592	5.2
LRR [sensitive, ls]	593	616	0.29
LRR [sensitive, ls]	593	616	7.7
LRR [sensitive, ls]	617	640	0.4
LRR [sensitive, ls]	617	640	11
LRR [sensitive, ls]	666	688	0.18
LRR [sensitive, ls]	666	688	4.7
LRR [sensitive, ls]	689	713	0.34
LRR [sensitive, ls]	689	713	9.1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	11	708	3e-86
Xa21 [O. sativa]	26	610	4e-80
CLV2 [A. thaliana]	45	741	5e-66
Cf-9 [L. pimpinellifolium]	46	696	6e-59
Cf-9 [L. pimpinellifolium]	56	176	6e-11
Cf-9 [L. pimpinellifolium]	64	394	1e-29
Cf-9 [L. pimpinellifolium]	64	371	2e-23
FLS2 [A.thaliana]	64	179	5e-16
FLS2 [A.thaliana]	65	205	6e-17
FLS2 [A.thaliana]	67	1097	1e-140
Cf-9 [L. pimpinellifolium]	71	466	3e-41
Xa21 [O. sativa]	191	901	8e-77
Xa21 [O. sativa]	522	710	2e-24
Pto [L. esculentum]	783	1090	3e-44
Rpg1 [Hordeum vulgare]	811	1093	1e-33
Rpg1 [Hordeum vulgare]	811	1093	9e-25

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	758	780	out -> in

Report for 3510.m00152

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)