Report for 3702.m00150

 > 3702.m00150, length: 1060, copies: 1 

MGSRGGALPVAVLVLLLLLVLKNGAAQSRCSSGDLAALRGFSAGLDGGVDGWPAGVGNASSSSTSDGGDCCAWRG

VACDEAGEVVGVVLPNATLRGVVAESLAGLAALRVLNLSSNALRGALPAGLLRLRALQVLDVSVNALEGAVAAAA

VVDLPAMREFNVSYNAFNGSHPVLAGAGRLTSYDVSGNSFAGHVDAAALCGASPGLRTLRLSMNGFSGDFPVGFG

QCRSLVELSLDGNAIAGALPDDVFGLTSLQVLSLHTNSLSGHLPPSLRNLSSLVRLDVSFNNFTGDLPDVFDAVP

GLQELSAPSNLLTGVLPATLSRCSRLRILNLRNNSLAGDIGLDFRALQSLVYLDLGVNRFTGPIPASLPECRAMT

ALNLGRNNLTGEIPATFAAFTSLSFLSLTGNSFSNVSSALRTLQGLPNLTSLVLTKNFHGGEAMPTDIAGFAGIE

VLVIANGELHGAIPAWLAGLSKLKVLDLSWNHLAGPIPPWLGELDRLFYLDVSNNSLHGEIPLKLAWMPALMAGG

DGSDEAHVQNFPFFIRPNSSARGRQYNQVSRFPPSLVLARNNLTGGVPAALGALTRVHVVDLSWNALSGPIPPEL

SGMSSVESLDVSHNALSGAIPPSLARLSFLSHFDVAYNNLSGEVPVGGQFSTFSRADFDGNPLLCGIHAARCAPQ

AVDGGGGGGRKDRSANAGVVAAIIVGTVLLLAVAAVATWRAWSRWQEDNARVAADDESGSLESAARSTLVLLFAN

DDDNGNGDDGERTMTLDDVLKATGNFDETRIVGCGGFGMVYRATLADGREVAVKRLSGDFWQMEREFRAEVETLS

RVRHRNLVTLQGYCRVGKDRLLIYPYMENGSLDHWLHERADVEGGGALPWPARLSIARGAARGLAHLHATSEPRV

LHRDIKSSNILLDARLEPRLADFGLARLVRAHDDTHVTTDLVGTLGYIPPEYGHSSVATYRGDVYSLGVVLLELV

TGRRPVDMARPAGGGRDVTSWALRMRREARGDEVVDASVGERRHRDEACRVLDVACACVSDNPKSRPTAQQLVEW

LDAIAAAAAD

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	107	130	0.77
LRR [Pfam ls]	229	252	0.56
LRR [Pfam ls]	253	276	0.054
LRR [Pfam ls]	277	300	0.18
LRR [Pfam ls]	325	348	0.24
LRR [Pfam ls]	349	372	6.5
LRR [Pfam ls]	373	396	2.2
LRR [Pfam ls]	397	419	5.3
LRR [Pfam ls]	472	495	1.6
LRR [Pfam ls]	581	604	5.7
LRR [Pfam ls]	605	628	0.072
Ser/Thr pkinase [Pfam fs]	776	980	8.6e-53
Ser/Thr pkinase [Pfam ls]	776	1051	2.5e-52

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	107	130	0.037
LRR [sensitive, ls]	107	130	0.77
LRR [sensitive, ls]	131	155	1.6
LRR [sensitive, ls]	131	155	33
LRR [sensitive, ls]	205	228	0.77
LRR [sensitive, ls]	205	228	16
LRR [sensitive, ls]	229	252	0.027
LRR [sensitive, ls]	229	252	0.56
LRR [sensitive, ls]	253	276	0.0026
LRR [sensitive, ls]	253	276	0.054
LRR [sensitive, ls]	277	300	0.0088
LRR [sensitive, ls]	277	300	0.18
LRR [sensitive, ls]	301	324	1.3
LRR [sensitive, ls]	301	324	28
LRR [sensitive, ls]	325	348	0.011
LRR [sensitive, ls]	325	348	0.24
LRR [sensitive, ls]	349	372	0.31
LRR [sensitive, ls]	349	372	6.5
LRR [sensitive, ls]	373	396	0.11
LRR [sensitive, ls]	373	396	2.2
LRR [sensitive, ls]	397	419	0.25
LRR [sensitive, ls]	397	419	5.3
LRR [sensitive, ls]	448	471	3.3
LRR [sensitive, ls]	448	471	70
LRR [sensitive, ls]	472	495	0.076
LRR [sensitive, ls]	472	495	1.6
LRR [sensitive, ls]	496	519	0.46
LRR [sensitive, ls]	496	519	9.6
LRR [sensitive, ls]	557	580	3.9
LRR [sensitive, ls]	557	580	81
LRR [sensitive, ls]	581	604	0.27
LRR [sensitive, ls]	581	604	5.7
LRR [sensitive, ls]	605	628	0.0035
LRR [sensitive, ls]	605	628	0.072
LRR [sensitive, ls]	629	651	3.6
LRR [sensitive, ls]	629	651	76

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	7	862	1e-73
FLS2 [A.thaliana]	13	645	7e-67
CLV2 [A. thaliana]	53	316	2e-15
CLV2 [A. thaliana]	61	678	6e-54
Cf-9 [L. pimpinellifolium]	70	657	5e-29
Cf-9 [L. pimpinellifolium]	87	406	1e-21
FLS2 [A.thaliana]	87	1051	8e-92
Cf-9 [L. pimpinellifolium]	89	512	4e-26
Cf-9 [L. pimpinellifolium]	108	720	5e-48
Pto [L. esculentum]	766	1043	5e-45
Rpg1 [Hordeum vulgare]	773	1054	7e-30
Rpg1 [Hordeum vulgare]	773	1054	5e-29

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	692	714	out -> in

Report for 3702.m00150

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)