Report for 3747.m00135

 > 3747.m00135, length: 791, copies: 3 

MSGLSRLTLSSNNLTGLIPSSIWNNMSALMAFTVQQNSLSGTIPPNAFSNFPSLQLIGMDHNKFHGSIPTSIANA

SHLWLVQLGANFLSGIVPPEIGGLRNLKILQLSETFLEARSPNDWKFITALTNCSQFSVLYLASCSFGGVLPDSL

SNLSSLTNLFLDTNKISGSIPEDIDNLINLQAFNLDNNNFTGHLPSSIGRLQNLHLLSIGNNKIGGPIPLTLGNL

TELYILQLRSNAFSGSIPSIFRNLTNLLGLSLDSNNFTGQIPTEVVSIVSLSEGLNLSNNNLEGSIPQQIGNLKN

LVNLDARSNKLSGEIPTTLGECQLLQNIYLQNNMLTGSLPSLLSQLKGLQTLDLSSNNLSGQIPTFLSNLTMLGY

LNLSFNDFVGEVPTLGVFLNASAISIQGNGKLCGGVPDLHLPRCTSQAPHRRQKFLVIPIVVSLVATLLLLLLFY

KLLARYKKIKSKIPSTTCMEGHPLISYSQLARATDSFSATNLLGSGSFGSVYKGELDKQSGQSKDIIAVKVLKLQ

TPGALKSFTAECEALRNLRHRNLVKIITACSSIDNSGNDFKAIVFDFMPSGNLEGWLHPATNNPKYLNLLQRVGI

LLDVANALDYLHCHGPTPVVHCDLKPSNVLLDAEMVAHVGDFGLAKILFEGNSLLQQSTSSMGLRGTIGYAPPEY

GAGNTVSTQGDIYSYGILVLETVTGKRPTDKKFIQGLSLREYVELGLHGKMMDVVDTQLSLHLENELRTTDEYKV

MIDCLVSLLRLGLYCSQEIPSNRMSTGDIIKELNAIKQTLL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	3	27	0.48
LRR [Pfam ls]	131	154	4.1
LRR [Pfam ls]	155	178	0.82
LRR [Pfam ls]	179	202	0.3
LRR [Pfam ls]	203	226	0.13
LRR [Pfam ls]	227	250	0.4
LRR [Pfam ls]	324	347	0.19
LRR [Pfam ls]	348	371	0.0053
Ser/Thr pkinase [Pfam fs]	487	705	5.6e-48
Ser/Thr pkinase [Pfam ls]	487	780	8.5e-40

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	3	27	0.044
LRR [sensitive, ls]	3	27	0.48
LRR [sensitive, ls]	28	52	0.72
LRR [sensitive, ls]	28	52	7.9
LRR [sensitive, ls]	53	76	1.5
LRR [sensitive, ls]	53	76	16
LRR [sensitive, ls]	77	100	2.9
LRR [sensitive, ls]	77	100	32
LRR [sensitive, ls]	101	124	2.3
LRR [sensitive, ls]	101	124	26
LRR [sensitive, ls]	131	154	0.38
LRR [sensitive, ls]	131	154	4.1
LRR [sensitive, ls]	155	178	0.075
LRR [sensitive, ls]	155	178	0.82
LRR [sensitive, ls]	179	202	0.027
LRR [sensitive, ls]	179	202	0.3
LRR [sensitive, ls]	203	226	0.012
LRR [sensitive, ls]	203	226	0.13
LRR [sensitive, ls]	227	250	0.036
LRR [sensitive, ls]	227	250	0.4
LRR [sensitive, ls]	251	275	1.3
LRR [sensitive, ls]	251	275	14
LRR [sensitive, ls]	276	299	0.56
LRR [sensitive, ls]	276	299	6.2
LRR [sensitive, ls]	300	323	0.51
LRR [sensitive, ls]	300	323	5.6
LRR [sensitive, ls]	324	347	0.017
LRR [sensitive, ls]	324	347	0.19
LRR [sensitive, ls]	348	371	0.00049
LRR [sensitive, ls]	348	371	0.0053
LRR [sensitive, ls]	372	394	2.9
LRR [sensitive, ls]	372	394	31

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	1	412	2e-36
CLV2 [A. thaliana]	1	412	3e-38
FLS2 [A.thaliana]	1	412	6e-54
FLS2 [A.thaliana]	1	787	1e-116
Xa21 [O. sativa]	1	412	3e-51
Cf-9 [L. pimpinellifolium]	2	412	2e-38
FLS2 [A.thaliana]	2	413	7e-59
FLS2 [A.thaliana]	2	412	2e-53
Cf-9 [L. pimpinellifolium]	4	417	5e-43
CLV2 [A. thaliana]	4	412	1e-37
FLS2 [A.thaliana]	4	388	1e-50
Xa21 [O. sativa]	4	598	0
Xa21 [O. sativa]	6	388	5e-53
FLS2 [A.thaliana]	9	413	5e-46
CLV2 [A. thaliana]	10	412	1e-35
Cf-9 [L. pimpinellifolium]	26	388	1e-35
Xa21 [O. sativa]	81	547	1e-39
Xa21 [O. sativa]	156	378	4e-30
Xa21 [O. sativa]	301	412	4e-12
Pto [L. esculentum]	454	783	7e-23
Rpg1 [Hordeum vulgare]	476	786	2e-23
Rpg1 [Hordeum vulgare]	484	786	8e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	431	453	out -> in

Report for 3747.m00135

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)