Report for 3747.m00142

 > 3747.m00142, length: 755, copies: 3 

MNMNPTSKPLLLLGSLLLLAASTLPLQATTACVPREWDALLAFKRGITSDPLGLLTSWKEDDHDCCRWRGVTCSN

LTGHVLRLHLNGGYDLDRFELVGLVGEISPQLLHLDHIEHLDLSINSLEGPSGQIPKFLGSMNSLRYLNLSSIPF

TGTVPPQLGNLSNLRYLDLSDMEGGVHLTDISWLPRLGSLKFLNLTYIDLSAASDWPYVMNMIPSLRVLSLSFCR

LQRANQSLTHFNLTKLEKLDLSMNYFDHPYASCWFWNLTILKFLDLSQNRLYDQLPIALGDMTSLRVLRISNNDL

GSMAPNLLRNLCNLEVLDLDESLSGGNMTELFGSLPQCSSSKLSELKMSYNNINGSLPAGLFRQFPNLVTLDMSI

NLITGPLPVEIANMETMAMEYLDIRSNKLSGQIPLLPRNLSALDIHNNSLSGPLPSEFGVNIYMLILSHNHLSGH

IPGSFCKMQYLDTIDLANNLFEGDFPQQCFSMKNIKVLLLSNNRFAGTFPAFLEGCIQLQIIDLSRNNFSSKLPK

WIGDKKDLVLLRLSYNAFSGVIPDNITNLPNLRQLDLAANSLSGNLPRSFTKLEGMKREDGYNASGSVPEDGLSS

NCLIGGIPEQIASLAALKNLNLSRNNLNGKIPYKIGSLQSLESLELSRNNLSGEIPSTLSNLSYLSNLDLSYNNL

SGTIPSGSQLGTLYMEHPDMYNGNNGLCGPPLRRNCSGDIEPRQHGYGDDNYCSIWGIFLGLAYSAHPFLIYSIS

ITLYR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	112	138	0.84
LRR [Pfam ls]	139	162	0.5
LRR [Pfam ls]	215	237	3.4
LRR [Pfam ls]	289	312	0.0042
LRR [Pfam ls]	342	366	0.019
LRR [Pfam ls]	367	390	4.7
LRR [Pfam ls]	393	416	3.7
LRR [Pfam ls]	436	459	0.18
LRR [Pfam ls]	484	507	5
LRR [Pfam ls]	508	531	2.2
LRR [Pfam ls]	532	555	0.13
LRR [Pfam ls]	556	579	0.18
LRR [Pfam ls]	616	639	0.92
LRR [Pfam ls]	640	663	0.002
LRR [Pfam ls]	664	686	0.57

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	112	138	0.076
LRR [sensitive, ls]	112	138	0.84
LRR [sensitive, ls]	139	162	0.046
LRR [sensitive, ls]	139	162	0.5
LRR [sensitive, ls]	215	237	0.31
LRR [sensitive, ls]	215	237	3.4
LRR [sensitive, ls]	240	264	5.7
LRR [sensitive, ls]	240	264	63
LRR [sensitive, ls]	265	288	0.81
LRR [sensitive, ls]	265	288	8.8
LRR [sensitive, ls]	289	312	0.00038
LRR [sensitive, ls]	289	312	0.0042
LRR [sensitive, ls]	313	336	4.2
LRR [sensitive, ls]	313	336	46
LRR [sensitive, ls]	342	366	0.0018
LRR [sensitive, ls]	342	366	0.019
LRR [sensitive, ls]	367	390	0.43
LRR [sensitive, ls]	367	390	4.7
LRR [sensitive, ls]	393	416	0.34
LRR [sensitive, ls]	393	416	3.7
LRR [sensitive, ls]	436	459	0.016
LRR [sensitive, ls]	436	459	0.18
LRR [sensitive, ls]	460	483	1.7
LRR [sensitive, ls]	460	483	19
LRR [sensitive, ls]	484	507	0.46
LRR [sensitive, ls]	484	507	5
LRR [sensitive, ls]	508	531	0.2
LRR [sensitive, ls]	508	531	2.2
LRR [sensitive, ls]	532	555	0.012
LRR [sensitive, ls]	532	555	0.13
LRR [sensitive, ls]	556	579	0.016
LRR [sensitive, ls]	556	579	0.18
LRR [sensitive, ls]	616	639	0.084
LRR [sensitive, ls]	616	639	0.92
LRR [sensitive, ls]	640	663	0.00019
LRR [sensitive, ls]	640	663	0.002
LRR [sensitive, ls]	664	686	0.052
LRR [sensitive, ls]	664	686	0.57

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	34	703	9e-58
FLS2 [A.thaliana]	36	680	7e-64
Xa21 [O. sativa]	39	704	5e-52
Cf-9 [L. pimpinellifolium]	57	714	2e-69
FLS2 [A.thaliana]	94	704	1e-62
Xa21 [O. sativa]	128	500	1e-24
CLV2 [A. thaliana]	201	706	3e-43
FLS2 [A.thaliana]	415	688	6e-31

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	729	751	out -> in

Report for 3747.m00142

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)