Report for 3770.m00258

 > 3770.m00258, length: 837, copies: 1 

MGKVAAMDNPHLVHTILLAQSLLLFTCLFLHSNCETITRDDEKAVLLSLERSWGGSVTVNWSSVIYEDQCNWPGI

NCTDGFVTGISLTGHGLNNLPAAICSLTKLSHIDLSRNSISGSFPTALYNCSNLRYLDLSYNTLVNSLPSNIDRL

SPRLVYLNLASNSLSGNIPSSIGQLKVLTNLYLDANQFNGSYPAEIGNISALRVLRLGDNPFLSGPIYPQFGNLT

NLEYLSMSKMNIIGKIPAAMSKANNVMFFDLSGNHLSGSIPSWIWSLKRLVTLQLYANHLSGQINAPIESTNLVE

IDVSSNNLSGQIPEDIGQLEELERLFLSNNHFTGSIPDSVALLPKLTNVQLFQNSFEGILPQELGKHSLLFNLET

HYNNFSGTLPEGLCSKGALAYISMSANMFSGELPASLLRCNSLNYVWLSNNNFSGTFPAGLTEVQIQEVNLSGRL

PSNWASNLVEIDLSNNKFSGRLPNTIRWLKSLGVLDLSENRFSGPIIPEIEFMNLTFLNLSDNQFSGQIPLLLQN

EKFKQSFLSNLGLCSSNHFADYPVCNERHLKNRLLIIFLALGLTSVLLIWLFGLLRIKVLPRRQNENTTTPRWKL

TAFHNINFNYQDIICGLADNNLIGSGGSGKVYKICLHNNSYRFVAAKKIVSDRSRSNMLEKHFQAEVEILGSIRH

ANVVRLLSSMSSTESKVLIYEYMENGSLYQWLHQKDMRNNNEPLSWPRRMSIAIDAARGLCYMHHDCSPPIAHCD

VKPSNILLDYEFKAKIADLGLARALAKAGEPESISTMVGSFGYMAPEFGSSRKINEKVDVYSFGVVLLELTTGRF

ANGGGGYENLAQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	104	127	0.56
LRR [Pfam ls]	128	151	0.027
LRR [Pfam ls]	153	176	0.15
LRR [Pfam ls]	250	273	4.4
LRR [Pfam ls]	297	320	0.037
LRR [Pfam ls]	321	344	0.046
LRR [Pfam ls]	417	437	2.1
LRR [Pfam ls]	457	480	0.19
LRR [Pfam ls]	504	527	0.21
Ser/Thr pkinase [Pfam fs]	617	834	4e-50
Ser/Thr pkinase [Pfam ls]	617	835	1e-27

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	104	127	0.024
LRR [sensitive, ls]	104	127	0.56
LRR [sensitive, ls]	128	151	0.0012
LRR [sensitive, ls]	128	151	0.027
LRR [sensitive, ls]	153	176	0.0065
LRR [sensitive, ls]	153	176	0.15
LRR [sensitive, ls]	177	200	3.8
LRR [sensitive, ls]	177	200	88
LRR [sensitive, ls]	201	225	0.57
LRR [sensitive, ls]	201	225	13
LRR [sensitive, ls]	226	246	1.2
LRR [sensitive, ls]	226	246	28
LRR [sensitive, ls]	250	273	0.19
LRR [sensitive, ls]	250	273	4.4
LRR [sensitive, ls]	274	296	2.5
LRR [sensitive, ls]	274	296	57
LRR [sensitive, ls]	297	320	0.0016
LRR [sensitive, ls]	297	320	0.037
LRR [sensitive, ls]	321	344	0.002
LRR [sensitive, ls]	321	344	0.046
LRR [sensitive, ls]	345	368	1.6
LRR [sensitive, ls]	345	368	37
LRR [sensitive, ls]	393	416	4
LRR [sensitive, ls]	393	416	93
LRR [sensitive, ls]	417	437	0.089
LRR [sensitive, ls]	417	437	2.1
LRR [sensitive, ls]	457	480	0.008
LRR [sensitive, ls]	457	480	0.19
LRR [sensitive, ls]	481	501	2.7
LRR [sensitive, ls]	481	501	62
LRR [sensitive, ls]	504	527	0.009
LRR [sensitive, ls]	504	527	0.21

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	17	708	1e-71
FLS2 [A.thaliana]	57	542	7e-48
CLV2 [A. thaliana]	63	520	8e-46
Cf-9 [L. pimpinellifolium]	70	520	4e-47
FLS2 [A.thaliana]	76	547	7e-53
Cf-9 [L. pimpinellifolium]	86	435	2e-30
FLS2 [A.thaliana]	86	362	8e-33
Cf-9 [L. pimpinellifolium]	93	496	9e-36
FLS2 [A.thaliana]	93	822	9e-85
N [N. glutinosa]	93	418	1e-10
CLV2 [A. thaliana]	94	365	4e-24
CLV2 [A. thaliana]	95	539	2e-40
Cf-9 [L. pimpinellifolium]	105	548	1e-45
CLV2 [A. thaliana]	105	538	5e-40
CLV2 [A. thaliana]	250	531	4e-27
Cf-9 [L. pimpinellifolium]	274	579	4e-16
Rpg1 [Hordeum vulgare]	596	824	1e-15
Rpg1 [Hordeum vulgare]	618	824	2e-22
Pto [L. esculentum]	619	826	2e-28

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	10	32	out -> in
putative TM domain	10	32	out -> in
putative TM domain	559	578	in -> out
putative TM domain	559	578	in -> out

Report for 3770.m00258

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)