Report for 3778.m00106

 > 3778.m00106, length: 997, copies: 1 

MLIPLLLLFYGVGNISGSTLPDNSTDMLSLLGFKEAITNDPSGVLSNWNTSIHLCSWNGVWCSPKHPGRVTALNL

AGQGLSGTISSSVGNLTFVRTLDLSNNNFSGQMPHLANLQKMQVLNLSFNTLDGIIPNTLTNCSNMRKLDLYTNL

LEGAIPPPIGRLRNLVYIDLSRNNLTGIIPASLKNISLLETIYLQRNQLEGSIPDELGQFSNISLMALGANRLSG

NIPASLFNLSSLRILELRANLLGGILPSNMGNHLTNLQHLFMGQNMFKGHVPASLGNASMLETIVLQSNNFTGRI

PTSLGKLSNLYKLDLELNMLEAKDTEGWKFLDALTNCTALEVLALAENQLQGVIPNSIGSLSNTLRYLVLGGNEL

SGIVPSCIGNLSGLIQLSLDVNKLTGSISPWIGNLKYLEYLNLGKNRFTGPIPYSIGSLTRLTELYLEKNAFEGH

IPPSLGNPPLLLKLDLTYNNLQGTIPWEISNLRQLVYLKLTSNKLTGNIPNALDRCQNLVTIQMDQNFLTGTIPI

SLGNLKGLSVLNLSHNILSGTIPAVLGDLPLLSKLDLSYNNLQGEIPRIELFRTSVYLEGNRGLCGGVMDLHMPS

CPQVSHRKERKSNLTRLLIPIVGFLSLTVLICLIYLVKKTPRRTYLSLLSFGKQFPRVSYKDIAQATGNFSQSNL

IGRGSYGSVYKAKLTPVKIQVAIKVFDLEMRWADKSFVSECEILRSIRHRNLLPILTACSTIDYSGNDFKALIYE

YMPNGNLDMWLHKKNTAVASKCLSLSQRVNIAVDIANALSYLHHECERSIIHCDLKPMNILLDSDMNAYLGDFGI

SSLVLESKFASLGHSCPNSLIGLKGTIGYIAPEYAECGNASTYGDVYGFGIVLLEMLTGKRPTDPMFENELNIVN

FMEKNFPEQIPHIIDAQLQEECKGFNQERIGQENRFYKCLLSVVQVALSCTHPIPRERMDIREIAIKLQAIRTSY

AEATKRDDMLRRRELQCTIELV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	93	115	0.13
LRR [Pfam ls]	116	139	0.11
LRR [Pfam ls]	140	163	4
LRR [Pfam ls]	164	187	0.0017
LRR [Pfam ls]	188	211	0.85
LRR [Pfam ls]	236	260	8.8
LRR [Pfam ls]	339	362	1.3
LRR [Pfam ls]	364	387	0.035
LRR [Pfam ls]	388	411	8.1
LRR [Pfam ls]	412	435	0.41
LRR [Pfam ls]	436	459	0.2
LRR [Pfam ls]	460	483	0.32
LRR [Pfam ls]	484	507	1.4
LRR [Pfam ls]	508	531	1.7
LRR [Pfam ls]	532	555	0.019
LRR [Pfam ls]	556	578	0.86
Ser/Thr pkinase [Pfam fs]	670	889	2.7e-46
Ser/Thr pkinase [Pfam ls]	670	946	2.9e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	69	92	0.99
LRR [sensitive, ls]	69	92	21
LRR [sensitive, ls]	93	115	0.0061
LRR [sensitive, ls]	93	115	0.13
LRR [sensitive, ls]	116	139	0.0052
LRR [sensitive, ls]	116	139	0.11
LRR [sensitive, ls]	140	163	0.19
LRR [sensitive, ls]	140	163	4
LRR [sensitive, ls]	164	187	8.4e-05
LRR [sensitive, ls]	164	187	0.0017
LRR [sensitive, ls]	188	211	0.041
LRR [sensitive, ls]	188	211	0.85
LRR [sensitive, ls]	212	235	4.1
LRR [sensitive, ls]	212	235	85
LRR [sensitive, ls]	236	260	0.42
LRR [sensitive, ls]	236	260	8.8
LRR [sensitive, ls]	261	284	0.43
LRR [sensitive, ls]	261	284	9
LRR [sensitive, ls]	285	308	0.48
LRR [sensitive, ls]	285	308	10
LRR [sensitive, ls]	309	338	6.8
LRR [sensitive, ls]	309	338	140
LRR [sensitive, ls]	339	362	0.061
LRR [sensitive, ls]	339	362	1.3
LRR [sensitive, ls]	364	387	0.0017
LRR [sensitive, ls]	364	387	0.035
LRR [sensitive, ls]	388	411	0.39
LRR [sensitive, ls]	388	411	8.1
LRR [sensitive, ls]	412	435	0.02
LRR [sensitive, ls]	412	435	0.41
LRR [sensitive, ls]	436	459	0.0095
LRR [sensitive, ls]	436	459	0.2
LRR [sensitive, ls]	460	483	0.015
LRR [sensitive, ls]	460	483	0.32
LRR [sensitive, ls]	484	507	0.069
LRR [sensitive, ls]	484	507	1.4
LRR [sensitive, ls]	508	531	0.083
LRR [sensitive, ls]	508	531	1.7
LRR [sensitive, ls]	532	555	0.00093
LRR [sensitive, ls]	532	555	0.019
LRR [sensitive, ls]	556	578	0.041
LRR [sensitive, ls]	556	578	0.86

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	1	573	2e-83
CLV2 [A. thaliana]	4	475	6e-30
Xa21 [O. sativa]	6	780	1e-159
CLV2 [A. thaliana]	15	571	1e-54
Cf-9 [L. pimpinellifolium]	28	571	5e-55
FLS2 [A.thaliana]	64	330	3e-31
Cf-9 [L. pimpinellifolium]	65	573	1e-52
FLS2 [A.thaliana]	69	972	1e-113
Cf-9 [L. pimpinellifolium]	70	500	1e-48
Cf-9 [L. pimpinellifolium]	229	652	6e-27
Pto [L. esculentum]	657	940	2e-24
Rpg1 [Hordeum vulgare]	659	885	5e-21
Rpg1 [Hordeum vulgare]	667	989	5e-19

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	615	637	out -> in

Report for 3778.m00106

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)