Report for 3793.m00273

 > 3793.m00273, length: 1104, copies: 2 

MPPRWRATATRLLVLLACACAVFVPRCHCVGDQGEALLRWKASLLNGTGGGGGGLDSWRASDASPCRWLGVSCDA

RGDVVAVTIKTVDLGGALPAASVLPLARSLKTLVLSGTNLTGAIPKELGDLAELSTLDLTKNQLTGAIPAELCRL

RKLQSLALNSNSLRGAIPDAIGNLTGLTSLTLYDNELSGAIPASIGNLKKLQVLRAGGNQALKGPLPPEIGGCTD

LTMLGLAETGISGSLPATIGNLKKIQTIAIYTAMLTGSIPESIGNCTELTSLYLYQNTLSGGIPPQLGQLKKLQT

VLLWQNQLVGTIPPEIGNCKELVLIDLSLNELTGPIPRSFGGLPNLQQLQLSTNKLTGVIPPELSNCTSLTDIEV

DNNQLTGAIGVDFPRLRNLTLFYAWQNRLTGGIPASLAQCEGLQSLDLSYNNLTGAIPRELFALQNLTKLLLLSN

DLAGFIPPEIGNCTNLYRLRLNGNRLSGTIPAEIGNLKNLNFLDLGGNRLTGPLPAAMSGCDNLEFMDLHSNALT

GTLPGDLPRSLQFVDVSDNRLTGVLGAGIGSLPELTKLNLGKNRISGGIPPELGSCEKLQLLDLGDNALSGGIPP

ELGKLPFLEISLNLSCNRLSGEIPSQFAGLDKLGCLDVSYNQLSGSLEPLARLENLVTLNISYNAFSGELPDTAF

FQKLPINDIAGNHLLVVGSGGDEATRRAAISSLKLAMTVLAVVSALLLLSATYVLARSRRSDSSGAIHGAGEAWE

VTLYQKLDFSVDEVVRSLTSANVIGTGSSGVVYRVGLPSGDSVAVKKMWSSDEAGAFRNEIAALGSIRHRNIVRL

LGWGANRSTKLLFYTYLPNGSLSGFLHRGGVKGAAEWAPRYDIALGVAHAVAYLHHDCLPAILHGDIKAMNVLLG

PRNEPYLADFGLARVLSGAVDSGSAKVDSSKPRIAGSYGYIAPEYASMQRISEKSDVYSFGVVVLEILTGRHPLD

PTLPGGTHLVQWVRDHLQAKRAVAELLDPRLRGKPEAQVQEMLQVFSVAVLCIAHRADDRPAMKDVVALLKEIRR

PVEGGATGGGEGKEQNAAAAAAAPPAAERRSPARSTLPKGGSSSCSFAMSDYSS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	104	127	0.41
LRR [Pfam ls]	128	151	0.49
LRR [Pfam ls]	152	175	0.1
LRR [Pfam ls]	176	199	0.085
LRR [Pfam ls]	273	296	0.028
LRR [Pfam ls]	297	320	4.1
LRR [Pfam ls]	321	344	0.12
LRR [Pfam ls]	345	368	0.011
LRR [Pfam ls]	369	392	4.2
LRR [Pfam ls]	417	440	0.013
LRR [Pfam ls]	465	488	0.01
LRR [Pfam ls]	489	512	1.7
LRR [Pfam ls]	513	533	1.1
LRR [Pfam ls]	535	558	0.96
LRR [Pfam ls]	559	582	0.13
LRR [Pfam fs]	583	606	6.1e-05
LRR [Pfam ls]	583	606	0.0011
LRR [Pfam ls]	632	654	5.1
LRR [Pfam ls]	655	679	0.91
Ser/Thr pkinase [Pfam fs]	768	975	1.6e-34
Ser/Thr pkinase [Pfam ls]	768	1042	3.5e-30

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	104	127	0.016
LRR [sensitive, ls]	104	127	0.41
LRR [sensitive, ls]	128	151	0.019
LRR [sensitive, ls]	128	151	0.49
LRR [sensitive, ls]	152	175	0.0039
LRR [sensitive, ls]	152	175	0.1
LRR [sensitive, ls]	176	199	0.0032
LRR [sensitive, ls]	176	199	0.085
LRR [sensitive, ls]	200	224	0.46
LRR [sensitive, ls]	200	224	12
LRR [sensitive, ls]	225	248	0.64
LRR [sensitive, ls]	225	248	17
LRR [sensitive, ls]	249	272	2.4
LRR [sensitive, ls]	249	272	65
LRR [sensitive, ls]	273	296	0.0011
LRR [sensitive, ls]	273	296	0.028
LRR [sensitive, ls]	297	320	0.15
LRR [sensitive, ls]	297	320	4.1
LRR [sensitive, ls]	321	344	0.0044
LRR [sensitive, ls]	321	344	0.12
LRR [sensitive, ls]	345	368	0.00042
LRR [sensitive, ls]	345	368	0.011
LRR [sensitive, ls]	369	392	0.16
LRR [sensitive, ls]	369	392	4.2
LRR [sensitive, ls]	393	416	0.9
LRR [sensitive, ls]	393	416	24
LRR [sensitive, ls]	417	440	0.0005
LRR [sensitive, ls]	417	440	0.013
LRR [sensitive, ls]	441	464	0.83
LRR [sensitive, ls]	441	464	22
LRR [sensitive, ls]	465	488	0.00038
LRR [sensitive, ls]	465	488	0.01
LRR [sensitive, ls]	489	512	0.063
LRR [sensitive, ls]	489	512	1.7
LRR [sensitive, ls]	513	533	0.043
LRR [sensitive, ls]	513	533	1.1
LRR [sensitive, ls]	535	558	0.036
LRR [sensitive, ls]	535	558	0.96
LRR [sensitive, ls]	559	582	0.0049
LRR [sensitive, ls]	559	582	0.13
LRR [sensitive, ls]	583	606	4e-05
LRR [sensitive, ls]	583	606	0.0011
LRR [sensitive, ls]	607	631	3.4
LRR [sensitive, ls]	607	631	89
LRR [sensitive, ls]	632	654	0.19
LRR [sensitive, ls]	632	654	5.1
LRR [sensitive, ls]	655	679	0.034
LRR [sensitive, ls]	655	679	0.91

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	36	852	5e-93
CLV2 [A. thaliana]	55	579	4e-52
Cf-9 [L. pimpinellifolium]	57	687	7e-65
FLS2 [A.thaliana]	66	675	1e-100
CLV2 [A. thaliana]	97	698	2e-61
Cf-9 [L. pimpinellifolium]	104	583	2e-40
FLS2 [A.thaliana]	105	1049	1e-149
Cf-9 [L. pimpinellifolium]	193	689	1e-34
Pto [L. esculentum]	733	1042	1e-33
Rpg1 [Hordeum vulgare]	753	1053	8e-27
Rpg1 [Hordeum vulgare]	761	971	8e-16

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3793.m00273

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)