Report for 3852.m00140

 > 3852.m00140, length: 1096, copies: 2 

MVATGFSFLLTLLLLATAVPPAPTTRAQPATDHLALMAFKSQITRDPSSAMASWGGNQSLHVCQWRGVTCGIQGR

CRGRVVALDLSNLDLSGTIDPSIGNLTYLRKLDLPVNHLTGTIPSELGRLLDLQHVNLSYNSLQGGIPASLSLCQ

QLENISLAFNHLSGGIPPAMGDLSMLRTVQLQYNMLDGAMPRMIGKLGSLEVLNLYNNSLAGSIPSEIGNLTSLV

SLILSYNHLTGSVPSSLGNLQRIKNLQLRGNQLSGPVPTFLGNLSSLTILNLGTNRFQGEIVSLQGLSSLTALIL

QENNLHGGIPSWLGNLSSLVYLSLGGNRLTGGIPESLAKLEKLSGLVLAENNLTGYNQFEGAIPTWMCNSSMLSS

FSIEMNMISGVVPPCVDGLNSLSVLTIQNNQLQANDSYGWGFLSSLTNSSQLEFLDFSSNKFRGTLPNAVANLST

NLKAFALSENMISGKIPEGIGNLVNLLYLFMSNNSFEGNIPSSLGTLWKLSHLDLGFNNLLGQIPPALGNLTSLN

KLYLGQNSLSGPLPSDLKNCTLEKIDIQHNMLSGPIPREVFLISTLSDFMYFQSNMFSGSLPLEISNLKNIADID

FSNNQISGEIPPSIGDCQSLQYFKIQGNFLQGPIPASVSRLKGLQVLDLSHNNFSGDIPQFLASMNGLASLNLSF

NHFEGPVPNDGIFLNINETAIEGNEGLCGGIPDLKLPLCSTHSTKKRSLKLIVAISISSGILLLILLLALFAFWQ

RNKTQAKSDLALINDSHLRVSYVELVNATNVFAPDNLIGVGSFGSVYKGRMTIQDQEVTVAVKVLNLQQRGASQS

FIAECEALRCVRHRNLVKILTVCSSIDIQGHDFKALVYEFMPNGNLDQWLHQHLEENGEDKVLNIIKRLDIAIDV

VSALDYLHQHRPLPIIHCDLKPSNILLDSEMVAHVGDFGLARVLHQDHSDMLEKSSGWATMRGTIGYAAPEYGLG

NEVSILGDVYSYGILLLEMFTGKRPTGTEFREALSLHNYVKMALPDNVIDIADQHLLSENNDGEEINSDGKRTRD

TRIACITSILQIGVSCSKESPADRMHIGEALKELQRTKDKFSLSLR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	79	102	3.7
LRR [Pfam ls]	103	126	7.4
LRR [Pfam ls]	127	150	0.36
LRR [Pfam ls]	151	174	1.2
LRR [Pfam ls]	199	222	0.0016
LRR [Pfam ls]	223	246	0.035
LRR [Pfam ls]	247	270	0.55
LRR [Pfam ls]	271	293	2
LRR [Pfam ls]	294	317	0.38
LRR [Pfam ls]	318	341	0.021
LRR [Pfam ls]	426	449	0.13
LRR [Pfam ls]	451	474	8.6
LRR [Pfam ls]	475	498	2.2
LRR [Pfam ls]	499	522	0.032
LRR [Pfam ls]	546	570	8.4
LRR [Pfam ls]	595	618	0.96
LRR [Pfam ls]	619	642	7.1
LRR [Pfam ls]	643	666	0.012
Ser/Thr pkinase [Pfam fs]	782	1001	1.2e-47
Ser/Thr pkinase [Pfam ls]	782	1086	1.2e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	79	102	0.18
LRR [sensitive, ls]	79	102	3.7
LRR [sensitive, ls]	103	126	0.35
LRR [sensitive, ls]	103	126	7.4
LRR [sensitive, ls]	127	150	0.017
LRR [sensitive, ls]	127	150	0.36
LRR [sensitive, ls]	151	174	0.057
LRR [sensitive, ls]	151	174	1.2
LRR [sensitive, ls]	175	198	4.1
LRR [sensitive, ls]	175	198	84
LRR [sensitive, ls]	199	222	7.8e-05
LRR [sensitive, ls]	199	222	0.0016
LRR [sensitive, ls]	223	246	0.0017
LRR [sensitive, ls]	223	246	0.035
LRR [sensitive, ls]	247	270	0.026
LRR [sensitive, ls]	247	270	0.55
LRR [sensitive, ls]	271	293	0.095
LRR [sensitive, ls]	271	293	2
LRR [sensitive, ls]	294	317	0.018
LRR [sensitive, ls]	294	317	0.38
LRR [sensitive, ls]	318	341	0.001
LRR [sensitive, ls]	318	341	0.021
LRR [sensitive, ls]	342	363	5.7
LRR [sensitive, ls]	342	363	120
LRR [sensitive, ls]	396	422	0.52
LRR [sensitive, ls]	396	422	11
LRR [sensitive, ls]	426	449	0.006
LRR [sensitive, ls]	426	449	0.13
LRR [sensitive, ls]	451	474	0.41
LRR [sensitive, ls]	451	474	8.6
LRR [sensitive, ls]	475	498	0.11
LRR [sensitive, ls]	475	498	2.2
LRR [sensitive, ls]	499	522	0.0015
LRR [sensitive, ls]	499	522	0.032
LRR [sensitive, ls]	523	543	0.92
LRR [sensitive, ls]	523	543	19
LRR [sensitive, ls]	546	570	0.41
LRR [sensitive, ls]	546	570	8.4
LRR [sensitive, ls]	595	618	0.046
LRR [sensitive, ls]	595	618	0.96
LRR [sensitive, ls]	619	642	0.34
LRR [sensitive, ls]	619	642	7.1
LRR [sensitive, ls]	643	666	0.00058
LRR [sensitive, ls]	643	666	0.012
LRR [sensitive, ls]	667	690	0.91
LRR [sensitive, ls]	667	690	19

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	6	749	5e-67
Xa21 [O. sativa]	30	894	1e-169
CLV2 [A. thaliana]	32	710	1e-64
FLS2 [A.thaliana]	35	708	1e-99
FLS2 [A.thaliana]	83	1090	1e-148
FLS2 [A.thaliana]	178	709	3e-77
Pto [L. esculentum]	754	1085	1e-24
Rpg1 [Hordeum vulgare]	775	1075	6e-27
Rpg1 [Hordeum vulgare]	775	998	4e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	727	749	out -> in

Report for 3852.m00140

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)