Report for 3855.m00183

 > 3855.m00183, length: 383, copies: 3 

MSSSLFLLPLLSLSFSFCSLSYGRPRGARAGANKLRVGAKNRFDRRIPPDLTNCTSLQFLDMSTNTLGGNMQEIL

GKFVALKYLVLHHNDYTGSIVSSNVLRLPLLARLDLSFNQFSGELPLEVVNMKSLKYVMLLANNFSGGIPATYPP

FNFVYTVMMRENCRSIWVRLLKGYGIIPICTNSSSPVRSNTISGYVQLSGNKLSGEIPSQIGAMRNLSLLHLDNN

QLTGHLPPEISQLPLVVLNVSSNIISGRIITGMVMFIMANLRVRFPVDQDPNPESLSCENPKCGGGGGKCGAFHM

SATSSPPSGCSSSCVTGCSRLLPPRTRYSAAAGGSIHAGRTLQRLHASPPAPPRPLLGLSSLPLPVDCSTREKVK

RRGGEKER

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	105	128	5.4
LRR [Pfam ls]	216	239	0.005

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	56	79	0.51
LRR [sensitive, ls]	56	79	12
LRR [sensitive, ls]	105	128	0.23
LRR [sensitive, ls]	105	128	5.4
LRR [sensitive, ls]	216	239	0.00022
LRR [sensitive, ls]	216	239	0.005

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	4	270	7e-15
FLS2 [A.thaliana]	8	254	2e-19
FLS2 [A.thaliana]	37	257	4e-13
Cf-9 [L. pimpinellifolium]	39	254	8e-11
CLV2 [A. thaliana]	39	254	9e-16
CLV2 [A. thaliana]	39	255	7e-13
FLS2 [A.thaliana]	40	254	1e-16
Cf-9 [L. pimpinellifolium]	41	254	9e-15
FLS2 [A.thaliana]	41	254	8e-15
Xa21 [O. sativa]	41	254	6e-16
Xa21 [O. sativa]	41	222	3e-14
Xa21 [O. sativa]	41	238	4e-13
Xa21 [O. sativa]	42	254	3e-16
CLV2 [A. thaliana]	46	254	8e-14
Cf-9 [L. pimpinellifolium]	47	254	3e-14
FLS2 [A.thaliana]	47	254	5e-16
CLV2 [A. thaliana]	50	254	2e-11
Xa21 [O. sativa]	60	256	1e-10

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3855.m00183

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)