Report for 3886.m00144

 > 3886.m00144, length: 1067, copies: 1 

MFTALKLLLLPYLLLLASASCTQGLPFSNNTDLDALLGFKAGLSHQSDALASWNTTTSYCQWSGVICSHRHKQRV

LALNLTSTGLHGYISASIGNLTYLRSLDLSCNQLYGEIPLTIGWLSKLSYLDLSNNSFQGEIPRTIGQLPQLSYL

YLSNNSLQGEITDELRNCTNLASIKLDLNSLNGKIPDWFGGFLKLNSISVGKNIFTGIIPQSLGNLSALSELFLN

ENHLTGPIPEALGKISSLERLALQVNHLSGTIPRTLLNLSSLIHIGLQENELHGRLPSDLGNGLPKIQYFIVALN

HFTGSIPPSIANATNMRSIDLSSNNFTGIIPPEIGMLCLKYLMLQRNQLKATSVKDWRFITFLTNCTRLRAVTIQ

NNRLGGALPNSITNLSAQLELLDIGFNKISGKIPDGINNFLKLIKLGLSNNRFSGPIPDSIGRLETLQYLTLENN

LLSGIIPSSLGNLTQLQQLSLDNNSLEGPLPASIGNLQQLIIATFSNNKLRDQLPGDIFNLPSLSYILDLSRNHF

SGSLPSAVGGLTKLTYLYMYSNNFSGLLPNSLSNCQSLMELHLDDNFFNGTIPVSVSKMRGLVLLNLTKNSLLGA

IPQDLRLMDGLKELYLSHNNLSAQIPENMENMTSLYWLDISFNNLDGQVPAHGVFANLTGFKTGFKFDGNDKLCG

GIRELHLPSCPTKPMEHSRSILLVTQKVVIPTAVTIFVCFILAAVVFSIRKKLRPSSMRTTVAPLPDGMYPRVSY

YELFQSTNGFNVNNLVGTGRYGSVYKGTMLLKKSETTVAIKVFNLEQSGSSKSFVAECNAISKIRHRNLIGVITC

CSCSGLNQNDFKAIVFKFMPHGNLDKWLHPEVHSSDPVKVLTLVQRLSIASDIAAALDYLHNSCHPTIVHCDFKP

SNILLGEDMVAHVGDLGLAKILTDPEGEQLINSKSSVGLMGTIGYIAPEYAECGQISPSGDVYSFGIVLLEMFTG

KAPTNDMFTDGLTLQKYAEMAYPARLIDIVDPHLLSIENTLGEINCVMSSVTRLALVCSRMKPTERLRMRDVADE

MQTIMASYVTEIDKVSL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	98	121	5
LRR [Pfam ls]	122	145	0.0084
LRR [Pfam ls]	146	169	0.029
LRR [Pfam ls]	194	217	2.5
LRR [Pfam ls]	218	241	1.2
LRR [Pfam ls]	266	290	3.6
LRR [Pfam ls]	315	338	2.9
LRR [Pfam ls]	393	416	0.36
LRR [Pfam ls]	417	440	0.23
LRR [Pfam ls]	441	464	0.0013
LRR [Pfam ls]	465	488	0.14
LRR [Pfam ls]	538	561	0.015
LRR [Pfam ls]	610	633	0.012
LRR [Pfam ls]	634	659	2.2
Ser/Thr pkinase [Pfam fs]	760	992	5e-41
Ser/Thr pkinase [Pfam ls]	760	1052	5e-37

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	74	97	2.6
LRR [sensitive, ls]	74	97	60
LRR [sensitive, ls]	98	121	0.21
LRR [sensitive, ls]	98	121	5
LRR [sensitive, ls]	122	145	0.00036
LRR [sensitive, ls]	122	145	0.0084
LRR [sensitive, ls]	146	169	0.0013
LRR [sensitive, ls]	146	169	0.029
LRR [sensitive, ls]	170	193	0.97
LRR [sensitive, ls]	170	193	23
LRR [sensitive, ls]	194	217	0.11
LRR [sensitive, ls]	194	217	2.5
LRR [sensitive, ls]	218	241	0.053
LRR [sensitive, ls]	218	241	1.2
LRR [sensitive, ls]	242	265	0.28
LRR [sensitive, ls]	242	265	6.5
LRR [sensitive, ls]	266	290	0.15
LRR [sensitive, ls]	266	290	3.6
LRR [sensitive, ls]	291	314	1.8
LRR [sensitive, ls]	291	314	43
LRR [sensitive, ls]	315	338	0.12
LRR [sensitive, ls]	315	338	2.9
LRR [sensitive, ls]	368	391	0.32
LRR [sensitive, ls]	368	391	7.4
LRR [sensitive, ls]	393	416	0.015
LRR [sensitive, ls]	393	416	0.36
LRR [sensitive, ls]	417	440	0.0097
LRR [sensitive, ls]	417	440	0.23
LRR [sensitive, ls]	441	464	5.6e-05
LRR [sensitive, ls]	441	464	0.0013
LRR [sensitive, ls]	465	488	0.0059
LRR [sensitive, ls]	465	488	0.14
LRR [sensitive, ls]	489	512	1.3
LRR [sensitive, ls]	489	512	30
LRR [sensitive, ls]	514	537	0.72
LRR [sensitive, ls]	514	537	17
LRR [sensitive, ls]	538	561	0.00063
LRR [sensitive, ls]	538	561	0.015
LRR [sensitive, ls]	562	585	0.4
LRR [sensitive, ls]	562	585	9.3
LRR [sensitive, ls]	586	609	0.55
LRR [sensitive, ls]	586	609	13
LRR [sensitive, ls]	610	633	0.0005
LRR [sensitive, ls]	610	633	0.012
LRR [sensitive, ls]	634	659	0.094
LRR [sensitive, ls]	634	659	2.2

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	5	873	1e-159
CLV2 [A. thaliana]	25	722	1e-62
FLS2 [A.thaliana]	32	650	1e-93
Cf-9 [L. pimpinellifolium]	52	641	2e-56
Cf-9 [L. pimpinellifolium]	68	505	1e-42
FLS2 [A.thaliana]	72	236	5e-14
FLS2 [A.thaliana]	75	599	3e-71
Cf-9 [L. pimpinellifolium]	78	259	2e-17
FLS2 [A.thaliana]	78	1054	1e-132
Cf-9 [L. pimpinellifolium]	95	705	2e-59
FLS2 [A.thaliana]	304	664	1e-50
Rpg1 [Hordeum vulgare]	739	976	2e-14
Pto [L. esculentum]	752	1009	8e-25
Rpg1 [Hordeum vulgare]	757	1065	1e-23

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	703	725	out -> in

Report for 3886.m00144

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)