Report for 4106.m00111

 > 4106.m00111, length: 453, copies: 1 

MGLVLTLLVLLVIMSSSTSTTVAEHHRIRSNDTDLAALLAFKARVSDPLGFLRDGWREDNASCFCQWIGVSCSRR

RQRVTALQLPGVPLQGTLTPHLGNLSFLIVLNLANTSLTGTLPGDIGKLHRLELLDLGYNALSGNIPATIGNLTK

LELLDLQFNRLSGPIPAELQGLRSLGSMNLRRNYLSGSIPVSVFNNTPLLAYLNIGNNSLSGLIPTAIGSLSMLQ

VLVLQYNQLSGSLPPTIFNMSRLEKLQASDNNLSGPIPFPTGNQSTIQLISLAFNSFTGRIPPRLAACRELQLLA

ISGNLLTDHVPEWLAGLSQLSSISLAANDLVGTVPAVLSNLTKLTVLDLSYSKLSGMIPLELGKLIQLNILHLSA

NQLTGPFPTSLGNLTKLSLLALDRNLLTGPLPVTLGNLRSLYHLHIAENHLQGELDFLAYLSNCRKLQFLDISMN

SSS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	102	125	1.4
LRR [Pfam ls]	126	149	0.036
LRR [Pfam ls]	150	173	0.033
LRR [Pfam ls]	174	198	3.4
LRR [Pfam ls]	199	222	0.18
LRR [Pfam ls]	223	246	1
LRR [Pfam ls]	295	318	0.6
LRR [Pfam ls]	343	366	0.38
LRR [Pfam ls]	367	390	0.24

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	78	101	6.7
LRR [sensitive, ls]	78	101	73
LRR [sensitive, ls]	102	125	0.13
LRR [sensitive, ls]	102	125	1.4
LRR [sensitive, ls]	126	149	0.0033
LRR [sensitive, ls]	126	149	0.036
LRR [sensitive, ls]	150	173	0.003
LRR [sensitive, ls]	150	173	0.033
LRR [sensitive, ls]	174	198	0.31
LRR [sensitive, ls]	174	198	3.4
LRR [sensitive, ls]	199	222	0.016
LRR [sensitive, ls]	199	222	0.18
LRR [sensitive, ls]	223	246	0.092
LRR [sensitive, ls]	223	246	1
LRR [sensitive, ls]	247	268	0.81
LRR [sensitive, ls]	247	268	8.8
LRR [sensitive, ls]	271	294	0.61
LRR [sensitive, ls]	271	294	6.7
LRR [sensitive, ls]	295	318	0.054
LRR [sensitive, ls]	295	318	0.6
LRR [sensitive, ls]	319	342	0.55
LRR [sensitive, ls]	319	342	6
LRR [sensitive, ls]	343	366	0.034
LRR [sensitive, ls]	343	366	0.38
LRR [sensitive, ls]	367	390	0.022
LRR [sensitive, ls]	367	390	0.24
LRR [sensitive, ls]	391	414	0.74
LRR [sensitive, ls]	391	414	8.1
LRR [sensitive, ls]	415	437	0.62
LRR [sensitive, ls]	415	437	6.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	17	453	5e-48
FLS2 [A.thaliana]	29	430	8e-60
Xa21 [O. sativa]	34	451	2e-53
Cf-9 [L. pimpinellifolium]	60	453	5e-35
Xa21 [O. sativa]	65	355	1e-34
CLV2 [A. thaliana]	70	404	1e-29
Cf-9 [L. pimpinellifolium]	75	383	2e-27
CLV2 [A. thaliana]	76	453	6e-39
FLS2 [A.thaliana]	76	430	2e-48
Cf-9 [L. pimpinellifolium]	77	428	4e-32
FLS2 [A.thaliana]	77	263	7e-27
CLV2 [A. thaliana]	78	286	2e-14
FLS2 [A.thaliana]	78	450	2e-49
Xa21 [O. sativa]	79	451	9e-49
Xa21 [O. sativa]	82	346	2e-31
FLS2 [A.thaliana]	89	385	5e-45
Xa21 [O. sativa]	91	385	2e-32
Cf-9 [L. pimpinellifolium]	104	212	2e-12
Cf-9 [L. pimpinellifolium]	106	450	1e-37
FLS2 [A.thaliana]	177	436	2e-37

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4106.m00111

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)