Report for 4117.m00189

 > 4117.m00189, length: 245, copies: 1 

MASAGSGGCGISAYATTRSPARYLTRSAIAPPSTSRTSTTTTSIVGGVPRWLDALPNLTVLRLSHNSLSGHIPPS

LANLTKIVQLEFDQNLMESSIPDGLSSLPALRMLALSHNSLTGEIPPSFFNMTSLRGLTLVNNVFRGELPADRRR

RMLPWRASARARETMRGAPTPGRGGSAGAGHPSHRSRTPTDDGGAWEFLNNLTNCNTLAEIFLDGNMFADVMLSS

VVVPSTISRLATSRSYSSST

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam fs]	57	80	1.2e-05
LRR [Pfam ls]	57	80	0.00019
LRR [Pfam ls]	105	128	0.035

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	57	80	6e-06
LRR [sensitive, ls]	57	80	0.00019
LRR [sensitive, ls]	81	104	0.45
LRR [sensitive, ls]	81	104	14
LRR [sensitive, ls]	105	128	0.0011
LRR [sensitive, ls]	105	128	0.035
LRR [sensitive, ls]	129	150	3.6
LRR [sensitive, ls]	129	150	110

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	32	146	2e-11
FLS2 [A.thaliana]	41	147	4e-13
Xa21 [O. sativa]	41	146	3e-11
CLV2 [A. thaliana]	43	145	1e-11
FLS2 [A.thaliana]	43	146	8e-12
Xa21 [O. sativa]	43	238	1e-15
FLS2 [A.thaliana]	44	147	1e-10
FLS2 [A.thaliana]	46	145	4e-12
Xa21 [O. sativa]	46	145	1e-12
Xa21 [O. sativa]	61	146	2e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4117.m00189

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)