Report for 4157.m00113

 > 4157.m00113, length: 833, copies: 1 

MDGTSAKVVLFIGASFSFFLITHAQQQATRCRPQERDALLSFKQGITNDSVGLLSSWRRGHGDCCSWAGITCSSK

TGHVVKLDVNSFLTDDSPMVGQISPSLLSLNYLQYLDLSSNLLAGPNGSVPEFLGSMNSLIHLDLSYIPFSGTLP

PLLSNLTNLEYLDLSFTSFSGTLPPQLGNLSNLRYLDVSEMQNVVYSTDLSWLSRLHLLEYIDMSNTILSKITNL

PAVLNKIPTLKHVLLLNCSIPSANQSITHLNLTQLEELDLSLNYFGHPISSCWFWKVTSIKSLRLDETYLHGPFP

DELGEMVSLQHLDFCFNGNAATMTVDLNNLCDLESIYLDKSLSSGNITDLMDKLQCSSKLYSLSSISNNMIGMLP

SSIEHFTSLNHIDLTNNSVSGVMPRGFQNMANLEYLHLSSNRLSGQMPLLPTSLKILHAQMNFLSGHLPLEFRAP

NLENLIISSNYITGQVPGSICESENMKHLDLSNNLFEGEVPHCRRMRNLRFLLLSNNSFSGKFPQWIQSFSSLVF

LDLSWNMFYGSLPRWIGDLVTLRILHLGHNMFNGDIPVNITHLTQLQYLNLADNNISGLIPLSLSHFNEMTLKAV

GDSISTLAFDESFDTFSLGMKHQILKYGSHGVVDMVGIDLSLNRITGGIPEEITSLDRLSNLNLSWNRLSGKIPE

NIGSMKSIESLDLSRNYLCGEVPSSLTDLTYLSYLDLSYNNLTGKVPSGRQLDTLYLENPSMYNGNIGLCGPPLQ

RNCSSNGYAQGHGDHKGQEKDSNSMFFYYGLASGFVVGYWVVFCALLFHKSWRVTYFCLVDKVYDKLYVYVVITW

TRWMNTTN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	107	133	1.1
LRR [Pfam ls]	134	157	0.56
LRR [Pfam ls]	158	181	0.0055
LRR [Pfam ls]	383	406	0.26
LRR [Pfam ls]	407	430	0.16
LRR [Pfam ls]	475	497	0.29
LRR [Pfam ls]	498	521	0.16
LRR [Pfam ls]	546	569	0.31
LRR [Pfam ls]	570	593	0.003
LRR [Pfam ls]	658	681	0.17
LRR [Pfam ls]	682	705	0.14
LRR [Pfam ls]	706	728	1.2

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	107	133	0.046
LRR [sensitive, ls]	107	133	1.1
LRR [sensitive, ls]	134	157	0.024
LRR [sensitive, ls]	134	157	0.56
LRR [sensitive, ls]	158	181	0.00024
LRR [sensitive, ls]	158	181	0.0055
LRR [sensitive, ls]	182	207	2.1
LRR [sensitive, ls]	182	207	48
LRR [sensitive, ls]	208	230	0.56
LRR [sensitive, ls]	208	230	13
LRR [sensitive, ls]	259	283	0.68
LRR [sensitive, ls]	259	283	16
LRR [sensitive, ls]	284	307	2.6
LRR [sensitive, ls]	284	307	61
LRR [sensitive, ls]	383	406	0.011
LRR [sensitive, ls]	383	406	0.26
LRR [sensitive, ls]	407	430	0.0067
LRR [sensitive, ls]	407	430	0.16
LRR [sensitive, ls]	451	474	0.31
LRR [sensitive, ls]	451	474	7.3
LRR [sensitive, ls]	475	497	0.012
LRR [sensitive, ls]	475	497	0.29
LRR [sensitive, ls]	498	521	0.007
LRR [sensitive, ls]	498	521	0.16
LRR [sensitive, ls]	522	545	0.26
LRR [sensitive, ls]	522	545	6.1
LRR [sensitive, ls]	546	569	0.013
LRR [sensitive, ls]	546	569	0.31
LRR [sensitive, ls]	570	593	0.00013
LRR [sensitive, ls]	570	593	0.003
LRR [sensitive, ls]	634	657	1.2
LRR [sensitive, ls]	634	657	29
LRR [sensitive, ls]	658	681	0.0073
LRR [sensitive, ls]	658	681	0.17
LRR [sensitive, ls]	682	705	0.0061
LRR [sensitive, ls]	682	705	0.14
LRR [sensitive, ls]	706	728	0.052
LRR [sensitive, ls]	706	728	1.2

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	6	746	3e-76
CLV2 [A. thaliana]	24	745	1e-55
Xa21 [O. sativa]	38	651	3e-54
Cf-9 [L. pimpinellifolium]	56	722	8e-46
Cf-9 [L. pimpinellifolium]	96	616	3e-25
Xa21 [O. sativa]	162	746	2e-43
CLV2 [A. thaliana]	224	748	5e-41
Xa21 [O. sativa]	285	722	3e-48
Xa21 [O. sativa]	529	722	2e-13

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	776	798	out -> in

Report for 4157.m00113

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)