Report for 4221.m00166

 > 4221.m00166, length: 401, copies: 1 

MASSSAAPILLLELAAAVLLVLQRVAAADAVVTTFPGDAAALASLKSAVDAATVPAYSCLASWDFARDPCAAFPC

GVRCYAPPNSSSYHRVTGVSLDPAGYSGTLPATVLASLPFLAFLSLASNRFHGALPAGSPLPPSLRVLDLSGNAF

SGEIPASLFTPASSLEELYLSRNALTGAIPPQVASLGSLKRMELQHNGLTGTLPRMDAMRSLAYLDLSGNALSGS

LLDAPGRLPGSLVSVVARGNGFAGPLQAAALAALPAMRVLDLTGNAVSGAVPGAAFAHPSLQQLRLGSNKLGAVE

EAPDGGASSQLVELDLGGNRLTGRLPGCVAAMPRLAVVGLDRNMFAGGIPDQYAARAAADGPTDKWVPFVRLMLQ

GNFLCGALPSQLRQLKEDGAVVEETV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	139	163	0.0034
LRR [Pfam ls]	164	187	0.056
LRR [Pfam ls]	188	210	7.3
LRR [Pfam ls]	211	234	0.46
LRR [Pfam ls]	261	285	4.9
LRR [Pfam ls]	310	333	0.5

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	115	137	2.9
LRR [sensitive, ls]	115	137	59
LRR [sensitive, ls]	139	163	0.00016
LRR [sensitive, ls]	139	163	0.0034
LRR [sensitive, ls]	164	187	0.0027
LRR [sensitive, ls]	164	187	0.056
LRR [sensitive, ls]	188	210	0.35
LRR [sensitive, ls]	188	210	7.3
LRR [sensitive, ls]	211	234	0.022
LRR [sensitive, ls]	211	234	0.46
LRR [sensitive, ls]	261	285	0.24
LRR [sensitive, ls]	261	285	4.9
LRR [sensitive, ls]	310	333	0.024
LRR [sensitive, ls]	310	333	0.5
LRR [sensitive, ls]	368	391	5.5
LRR [sensitive, ls]	368	391	110

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	8	352	3e-14
FLS2 [A.thaliana]	42	352	6e-17
Xa21 [O. sativa]	82	326	2e-12
FLS2 [A.thaliana]	83	352	5e-21
Cf-9 [L. pimpinellifolium]	91	390	4e-12
Cf-9 [L. pimpinellifolium]	94	352	5e-15
Cf-9 [L. pimpinellifolium]	94	349	5e-11
CLV2 [A. thaliana]	94	352	3e-18
CLV2 [A. thaliana]	94	350	5e-16
FLS2 [A.thaliana]	94	350	3e-17
FLS2 [A.thaliana]	100	351	2e-21
CLV2 [A. thaliana]	101	391	7e-15
FLS2 [A.thaliana]	101	319	1e-20
Xa21 [O. sativa]	102	391	1e-17
Xa21 [O. sativa]	108	384	3e-17
CLV2 [A. thaliana]	110	390	5e-19
FLS2 [A.thaliana]	113	390	2e-19
CLV2 [A. thaliana]	116	351	3e-19
Cf-9 [L. pimpinellifolium]	119	220	1e-10

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4221.m00166

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)