Report for 4241.m00209

 > 4241.m00209, length: 477, copies: 1 

MDLLGFAVVLLLSLASSTSSCKDHEKSFFLQFLAGLSEDGGLAVSWQNDTDCCTWEGITCGTDATITEISLVSKG

LEGHISPYLGNLTGLMRLNLSHNLLSGELPLEELVSSTSLVILDISFNHLSGALQEFSAQISETTIRPLQVLNIS

SNLFTAQFPTNTWKVMNNLVALNASNNSFTGQAPSSFCISAPSITELDLSFNRFGGSVPQDIGNCSMLRVLKGGH

NNFHGALPDELFNASSLEYLSFPDNVLNGVLDDANIIKLRKLSILDLERNMFIGKIPNSIGQLKRLEELHLGHNN

MYGELPLTLGNCTNLKILDLKINYLSGDLGKINFSSLSNLMIIDLLVNNFNGTIPESIYDCTNLIALRLSWNKFH

GEFSQRMDRLRSLSFLSVGGNAFANIRNALHIFKSFRNLTVLSIEQNFMHEILPEDETIDGFESLQHLEIYGSSL

SGKMPVWLSKLKNLEKLFLYDNRLTGT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	193	216	0.19
LRR [Pfam ls]	266	289	3.8
LRR [Pfam ls]	290	313	1.5
LRR [Pfam ls]	439	462	0.59

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	89	113	0.52
LRR [sensitive, ls]	89	113	11
LRR [sensitive, ls]	114	136	0.64
LRR [sensitive, ls]	114	136	13
LRR [sensitive, ls]	143	167	0.57
LRR [sensitive, ls]	143	167	12
LRR [sensitive, ls]	168	192	0.91
LRR [sensitive, ls]	168	192	19
LRR [sensitive, ls]	193	216	0.0091
LRR [sensitive, ls]	193	216	0.19
LRR [sensitive, ls]	241	265	3.1
LRR [sensitive, ls]	241	265	65
LRR [sensitive, ls]	266	289	0.18
LRR [sensitive, ls]	266	289	3.8
LRR [sensitive, ls]	290	313	0.071
LRR [sensitive, ls]	290	313	1.5
LRR [sensitive, ls]	314	341	0.56
LRR [sensitive, ls]	314	341	12
LRR [sensitive, ls]	363	386	5.4
LRR [sensitive, ls]	363	386	110
LRR [sensitive, ls]	387	409	3.2
LRR [sensitive, ls]	387	409	66
LRR [sensitive, ls]	413	433	6
LRR [sensitive, ls]	413	433	120
LRR [sensitive, ls]	439	462	0.029
LRR [sensitive, ls]	439	462	0.59

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	3	468	1e-38
FLS2 [A.thaliana]	32	476	2e-42
Cf-9 [L. pimpinellifolium]	44	477	1e-27
FLS2 [A.thaliana]	58	477	3e-40
Xa21 [O. sativa]	58	255	1e-12
CLV2 [A. thaliana]	61	437	6e-28
Xa21 [O. sativa]	64	476	4e-27
Xa21 [O. sativa]	64	306	6e-21
CLV2 [A. thaliana]	65	476	1e-27
FLS2 [A.thaliana]	65	263	2e-17
Cf-9 [L. pimpinellifolium]	66	455	2e-27
Cf-9 [L. pimpinellifolium]	66	437	2e-22
FLS2 [A.thaliana]	66	476	1e-32
FLS2 [A.thaliana]	66	422	9e-32
CLV2 [A. thaliana]	73	475	1e-32
Cf-9 [L. pimpinellifolium]	84	477	2e-26
Xa21 [O. sativa]	84	377	2e-33
CLV2 [A. thaliana]	99	476	2e-29
CLV2 [A. thaliana]	169	477	8e-20
Xa21 [O. sativa]	197	477	5e-31

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4241.m00209

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)