Report for 4241.m00211

 > 4241.m00211, length: 288, copies: 2 

MSGELPSALGNCTSLKIIGIKHNNFIGDIPGSIGQLNRLEELQLDNNRMSRVFPSSLSNFTSLKIINLKHNNFTG

ELSKVNFSRLPNLKLLDLMSNKFTGEILDSIYRCSNLTTLQLSSNKFYGQLSPRIDNLKSLVFAGVFELPVYADY

EEPSLTYGMTNALPAMLNLGNNKLTGAIPSEVGQLKSLTVLFLSFNSSSGHIPPKLFNLTNLQVLELSNLHLTGS

IPPGLNNVHSLSIFDVSNNDLEGSVPIGYEYWGFDGNPKLCGFPMKGGKYKNKEKDIGGNSFF

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	38	61	0.17
LRR [Pfam ls]	62	86	0.85
LRR [Pfam ls]	111	134	0.82
LRR [Pfam ls]	211	234	0.072

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	14	37	1.4
LRR [sensitive, ls]	14	37	30
LRR [sensitive, ls]	38	61	0.0081
LRR [sensitive, ls]	38	61	0.17
LRR [sensitive, ls]	62	86	0.041
LRR [sensitive, ls]	62	86	0.85
LRR [sensitive, ls]	87	110	1.4
LRR [sensitive, ls]	87	110	30
LRR [sensitive, ls]	111	134	0.039
LRR [sensitive, ls]	111	134	0.82
LRR [sensitive, ls]	163	186	1.2
LRR [sensitive, ls]	163	186	26
LRR [sensitive, ls]	187	210	2
LRR [sensitive, ls]	187	210	42
LRR [sensitive, ls]	211	234	0.0035
LRR [sensitive, ls]	211	234	0.072
LRR [sensitive, ls]	235	269	4.9
LRR [sensitive, ls]	235	269	100

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	1	270	6e-24
Cf-9 [L. pimpinellifolium]	1	251	4e-20
CLV2 [A. thaliana]	1	252	2e-24
CLV2 [A. thaliana]	1	266	7e-24
CLV2 [A. thaliana]	1	252	5e-22
FLS2 [A.thaliana]	1	254	3e-27
FLS2 [A.thaliana]	1	278	3e-26
FLS2 [A.thaliana]	1	250	1e-20
Xa21 [O. sativa]	1	252	3e-31
Xa21 [O. sativa]	1	277	3e-24
Xa21 [O. sativa]	1	251	3e-21
CLV2 [A. thaliana]	2	257	6e-26
FLS2 [A.thaliana]	2	251	2e-37
FLS2 [A.thaliana]	2	251	1e-24
Xa21 [O. sativa]	7	252	4e-25
FLS2 [A.thaliana]	9	251	1e-16
Cf-9 [L. pimpinellifolium]	10	260	5e-11
Cf-9 [L. pimpinellifolium]	14	242	3e-12
Xa21 [O. sativa]	20	251	9e-20
FLS2 [A.thaliana]	39	251	9e-16
Xa21 [O. sativa]	66	251	7e-17
Xa21 [O. sativa]	167	254	5e-13

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4241.m00211

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)