Report for 4299.m00166

 > 4299.m00166, length: 1036, copies: 2 

MMQLTTTWPWRFFFCLFFHLLFLFPTNSLNQSYCDPGDASALLGFMQGLSGSGSGWTVPNATSETANCCAWLGVK

CNDGGRVIGLDLQGMKLRGELAVSLGQLDQLQWLNLSSNNLHGAVPATLVQLQRLQRLDLSDNEFSGEFPTNVSL

PVIEVFNISLNSFKEQHPTLHGSTLLAMFDAGYNMFTGHIDTSICDPNGVIRVLRFTSNLLSGEFPAGFGNCTKL

EELYVDLNSITGSLPDDLFRLSSLRDLSLQENQLSGRMTPRFGNMSSLSKLDISFNSFSGYLPNVFGSLGKLEYF

SAQSNLFRGPLPSSLSHSPSLKMLYLRNNSFHGQIDLNCSAMSQLSSLDLGTNKFIGTIDALSDCHHLRSLNLAT

NNLTGEIPNGFRNLQFLTYISLSNNSFTNVSSALSVLQGCPSLTSLVLTKNFNDGKALPMTGIDGFHNIQVFVIA

NSHLSGSVPSWVANFAQLKVLDLSWNKLSGNIPAWIGNLEHLFYLDLSNNTLSGGIPNSLTSMKGLLTCNSSQQS

TETDYFPFFIKKNRTGKGLRYNQVSSFPPSLILSHNMLIGPILPGFGNLKNLHVLDLSNNHISGMIPDELSGMSS

LESLDLSHNNLTGSIPSSLTKLNFLSSFSVAFNNLTGAIPLGGQFSTFTGSAYEGNPKLCGIRSGLALCQSSHAP

TMSVKKNGKNKGVILGIAIGIALGAAFVLSVAVVLVLKSSFRRQDYIVKAVADTTEALELAPASLVLLFQNKDDG

KAMTIGDILKSTNNFDQANIIGCGGFGLVYKATLPDGATIAIKRLSGDFGQMEREFKAEVETLSKAQHPNLVLLQ

GYCRIGNDRLLIYSYMENGSLDHWLHEKPDGPSRLSWQTRLQIAKGAARGLAYLHLSCQPHILHRDIKSSNILLD

EDFEAHLADFGLARLICPYDTHVTTDLVGTLGYIPPEYGQSSVANFKELLTGKRPVDMCKPKGARELVSWVLHMK

EKNCEAEVLDRAMYDKKFEMQMVQMIDIACLCISESPKLRPLTHELVLWLDNIGGSTEATK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	105	128	1.3
LRR [Pfam ls]	129	157	1.5
LRR [Pfam ls]	200	223	8.3
LRR [Pfam ls]	224	247	1.5
LRR [Pfam ls]	248	271	1.8
LRR [Pfam ls]	272	295	0.57
LRR [Pfam ls]	367	390	0.007
LRR [Pfam ls]	391	413	0.41
LRR [Pfam ls]	467	490	0.047
LRR [Pfam ls]	491	514	0.04
LRR [Pfam fs]	576	599	2.6e-05
LRR [Pfam ls]	576	599	0.00041
LRR [Pfam fs]	600	623	3.6e-05
LRR [Pfam ls]	600	623	0.0006
Ser/Thr pkinase [Pfam fs]	765	937	2.7e-40
Ser/Thr pkinase [Pfam ls]	765	1025	8.4e-33

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	105	128	0.06
LRR [sensitive, ls]	105	128	1.3
LRR [sensitive, ls]	129	157	0.07
LRR [sensitive, ls]	129	157	1.5
LRR [sensitive, ls]	200	223	0.4
LRR [sensitive, ls]	200	223	8.3
LRR [sensitive, ls]	224	247	0.074
LRR [sensitive, ls]	224	247	1.5
LRR [sensitive, ls]	248	271	0.087
LRR [sensitive, ls]	248	271	1.8
LRR [sensitive, ls]	272	295	0.027
LRR [sensitive, ls]	272	295	0.57
LRR [sensitive, ls]	296	319	1.6
LRR [sensitive, ls]	296	319	34
LRR [sensitive, ls]	320	343	0.68
LRR [sensitive, ls]	320	343	14
LRR [sensitive, ls]	344	366	1.2
LRR [sensitive, ls]	344	366	26
LRR [sensitive, ls]	367	390	0.00034
LRR [sensitive, ls]	367	390	0.007
LRR [sensitive, ls]	391	413	0.02
LRR [sensitive, ls]	391	413	0.41
LRR [sensitive, ls]	443	466	3.6
LRR [sensitive, ls]	443	466	75
LRR [sensitive, ls]	467	490	0.0022
LRR [sensitive, ls]	467	490	0.047
LRR [sensitive, ls]	491	514	0.0019
LRR [sensitive, ls]	491	514	0.04
LRR [sensitive, ls]	576	599	2e-05
LRR [sensitive, ls]	576	599	0.00041
LRR [sensitive, ls]	600	623	2.9e-05
LRR [sensitive, ls]	600	623	0.0006

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	14	727	6e-63
Xa21 [O. sativa]	14	851	5e-85
FLS2 [A.thaliana]	16	656	2e-61
Cf-9 [L. pimpinellifolium]	63	650	3e-40
FLS2 [A.thaliana]	84	365	2e-22
Cf-9 [L. pimpinellifolium]	85	507	1e-30
FLS2 [A.thaliana]	85	640	1e-51
FLS2 [A.thaliana]	91	1034	8e-97
Cf-9 [L. pimpinellifolium]	105	522	6e-30
Cf-9 [L. pimpinellifolium]	106	729	2e-49
Pto [L. esculentum]	746	1024	7e-42
Rpg1 [Hordeum vulgare]	754	1028	3e-27
Rpg1 [Hordeum vulgare]	762	1029	3e-29

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	24	in -> out
putative TM domain	690	712	out -> in

Report for 4299.m00166

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)