Report for 4356.m00192

 > 4356.m00192, length: 1069, copies: 2 

MAIKWQLSMLSLLTHALLLLTASSQTINGDDLSALMSFKSLIRNDPRGVLSSWDAIGNGTNMTAPVFCQWTGVTC

NDRQYPSRVTTLNLRDAGLTGTISQQLGNLTHLHVLDLSANSLDGDIPTSLGGCPKLRSLNFSRNHLSGTIPADL

GKLSKLAVFDIGHNNLTCDIPKSLSNLTTLTKFIVERNFIHGQDLSWMGNLTTLTHFVLEGNSFTGNIPETFGKM

VKLIYFSVQDNHLEGHVPLSIFNISSIRFFDLGFNRLSGSLPLDVGVKLPRINRFNTLANHFEGIIPPTFSNASA

LESLLLRGNNYHGIIPREIGIHGNLKVFSLGDNALQATRPSDWEFFISLTNCSSLRFLDIGKNNLVGAMPINIAN

LSNELSWIDLGGNQIIGTIPEDLWKFNKLTSVNLSYNLFTGTLPPDIGGLPRLNSFYISHNRIDGKIPQSLGNIT

QLSYLSLSNNFLDGSIPTSLGNFTKLEVMDLSCNSLTGQIPQEILAITSLTRRLNLSNNALIGSIPTQIGLLNSL

VKMDMSMNKLSGGIPEAIGSCVQLSSLNFQGNLLQGQIPKSLNNLRSLQILDLSKNSLEGRIPEFLANFTFLTNL

NLSFNKLSGPVPNTGIFRNVTIVLLLGNKMLCGGPPYMQFPSCSYEDSDQASVHRLHVLIFCIVGTLISSMCCMT

AYCFIKRKMKLNVVDNENLFLNETNERISYAELQAATNSFSPANLIGSGSFGHVYIGNLIIDQNLVPVAIKVLNL

SQRGASRSFLTECDALRRIRHRKLVKVITVCSGSDQNGDEFKALVLEFICNGTLDEWLHANTTAVRRSYTRINLM

KRLHIALDVADALEYLHHHIVPPIVHCDIKPSNILLDDDLVAHVTDFGLARIMNIAEPFKESSSFVIKGTIGYVA

PEYGSGSQVSMDGDIYSYGVLLLEMFTGRRPTDNFNYGTTSLVDYPTCGPAQCRRPPHANAQRQLPLLPLPAASE

PQSVLLPRLRHVHQQAQQVAPPLSPVISEGRDVEDADPNLPGFFKNPSHLSDDEIGEDRSPLAAEPDGFLGDDEG

DNAPSESDIATELDDLDSA

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	83	106	4.6
LRR [Pfam ls]	107	130	0.28
LRR [Pfam ls]	131	154	0.0029
LRR [Pfam ls]	155	178	0.18
LRR [Pfam ls]	203	226	4.8
LRR [Pfam ls]	251	275	3.2
LRR [Pfam ls]	354	377	3.6
LRR [Pfam ls]	379	402	1.5
LRR [Pfam ls]	403	426	0.0038
LRR [Pfam ls]	427	450	5.5
LRR [Pfam ls]	451	474	0.19
LRR [Pfam ls]	475	499	1
LRR [Pfam ls]	548	571	0.58
LRR [Pfam ls]	572	595	0.011
LRR [Pfam ls]	596	621	5.7
Ser/Thr pkinase [Pfam fs]	715	937	2.4e-42
Ser/Thr pkinase [Pfam ls]	715	994	3.4e-34

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	83	106	0.18
LRR [sensitive, ls]	83	106	4.6
LRR [sensitive, ls]	107	130	0.011
LRR [sensitive, ls]	107	130	0.28
LRR [sensitive, ls]	131	154	0.00011
LRR [sensitive, ls]	131	154	0.0029
LRR [sensitive, ls]	155	178	0.0068
LRR [sensitive, ls]	155	178	0.18
LRR [sensitive, ls]	203	226	0.18
LRR [sensitive, ls]	203	226	4.8
LRR [sensitive, ls]	227	250	2.4
LRR [sensitive, ls]	227	250	62
LRR [sensitive, ls]	251	275	0.12
LRR [sensitive, ls]	251	275	3.2
LRR [sensitive, ls]	324	347	1.6
LRR [sensitive, ls]	324	347	42
LRR [sensitive, ls]	354	377	0.14
LRR [sensitive, ls]	354	377	3.6
LRR [sensitive, ls]	379	402	0.057
LRR [sensitive, ls]	379	402	1.5
LRR [sensitive, ls]	403	426	0.00014
LRR [sensitive, ls]	403	426	0.0038
LRR [sensitive, ls]	427	450	0.21
LRR [sensitive, ls]	427	450	5.5
LRR [sensitive, ls]	451	474	0.007
LRR [sensitive, ls]	451	474	0.19
LRR [sensitive, ls]	475	499	0.039
LRR [sensitive, ls]	475	499	1
LRR [sensitive, ls]	500	523	0.47
LRR [sensitive, ls]	500	523	12
LRR [sensitive, ls]	524	547	1.2
LRR [sensitive, ls]	524	547	32
LRR [sensitive, ls]	548	571	0.022
LRR [sensitive, ls]	548	571	0.58
LRR [sensitive, ls]	572	595	0.00042
LRR [sensitive, ls]	572	595	0.011
LRR [sensitive, ls]	596	621	0.22
LRR [sensitive, ls]	596	621	5.7

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	3	812	1e-149
FLS2 [A.thaliana]	10	636	1e-79
CLV2 [A. thaliana]	16	678	1e-48
Cf-9 [L. pimpinellifolium]	68	612	2e-45
Cf-9 [L. pimpinellifolium]	80	642	8e-54
FLS2 [A.thaliana]	82	932	1e-121
CLV2 [A. thaliana]	201	616	2e-44
Rpg1 [Hordeum vulgare]	680	935	6e-29
Pto [L. esculentum]	702	929	4e-23
Rpg1 [Hordeum vulgare]	708	929	2e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4356.m00192

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)