Report for 4356.m00196

 > 4356.m00196, length: 1011, copies: 2 

METMLSLLTHALLLQTVTSQTINGDDLSALLSFKSLIRDDPREVMSSWDTAGNGTNMPAPVICQWTGVSCNNRRH

PGRVTTLRLSGAGLVGTISPQLGNLTHLRVLDLSANSLDGDIPASLGGCRKLRTLNLSTNHLSGSIPDDLGQSSK

LAIFDVGHNNLTGNVPKSFSNLTTLVKFIIETNFIDGKDLSWMGNLTSLTHFVLEGNRFTGNIPESFGKMANLIY

FNVKDNQLEGHVPLPIFNISSIRFLDLGFNRLSGSLPLDIGFKLPRIKIFSTIANHFEGIIPPTFSNASALESLQ

LRGNKYHGMIPREIGIHGNLKFFALGDNVLQATRPSDLEFFTSLTNCSSLQMLDVGQNNLVGAMPINIANLSGEL

SWIDLSGNQLIGTIPADLWKLKLTSLNLSYNLFTGTLPHDIGWLTRINSIYVSHNRITGQIPQSLGNASQLSSLT

LSNNFLDGSIPSSLGNLTKLQYLDLSGNALMGQIPQEILTIPSLTKLLSLSNNALSGSIPRQIGLLNSLVKMDLS

MNKLSGEIPKAIGSCVQLSFLNFKGNLLQGQIPENLNNLRSLEILDLSNNNLAGPIPEFLANFTLLTNLNLSFNA

LSGPVPNTGIFCNGTIVSLSGNTMLCGGPPDLQFPSCPSKDSDQASVHRLHVLIFCIVGTLIFSLFCMTAYCFIK

TRMKPNIIDNENLFLYETNERISYAELQAATESFSPANLIGSGSFGNVYIGNLIIDQNLVPIAVKVLNLSQRGAS

RSFLTECDALRRIRHRKLVKVITICSGSDQNGDEFKALVLEFICNGSLDEWLHASTAAISTSYRRLNLMKRLHIA

LDVAEALEYLHHHIVPPIVHCDIKPSNILLDDDMVAHVTDFGLAKIINIAEPCKESSSFVIKGTIGYVAPEYGSG

SPVSMDGDIYSYGVLLLEMFTGRRPTDNFINGMASLIDYVKTAYPNNLLEILDTNATYNGNTQDMTQLVVYPIFR

LGLACCKESPRERMKMDNVVKELNAIKKAFSAHTYA

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	78	101	2.7
LRR [Pfam ls]	102	125	0.066
LRR [Pfam ls]	126	149	0.041
LRR [Pfam ls]	150	173	0.48
LRR [Pfam ls]	198	221	1.8
LRR [Pfam ls]	246	270	0.13
LRR [Pfam ls]	374	395	6.2
LRR [Pfam ls]	397	420	0.054
LRR [Pfam ls]	421	444	3.4
LRR [Pfam ls]	445	468	0.15
LRR [Pfam ls]	469	493	0.23
LRR [Pfam ls]	542	565	2.5
LRR [Pfam ls]	566	589	0.0012
Ser/Thr pkinase [Pfam fs]	709	942	1.3e-41
Ser/Thr pkinase [Pfam ls]	709	1000	1.6e-37

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	78	101	0.1
LRR [sensitive, ls]	78	101	2.7
LRR [sensitive, ls]	102	125	0.0025
LRR [sensitive, ls]	102	125	0.066
LRR [sensitive, ls]	126	149	0.0016
LRR [sensitive, ls]	126	149	0.041
LRR [sensitive, ls]	150	173	0.018
LRR [sensitive, ls]	150	173	0.48
LRR [sensitive, ls]	198	221	0.069
LRR [sensitive, ls]	198	221	1.8
LRR [sensitive, ls]	246	270	0.0051
LRR [sensitive, ls]	246	270	0.13
LRR [sensitive, ls]	319	345	1.7
LRR [sensitive, ls]	319	345	45
LRR [sensitive, ls]	349	372	0.27
LRR [sensitive, ls]	349	372	7.3
LRR [sensitive, ls]	374	395	0.23
LRR [sensitive, ls]	374	395	6.2
LRR [sensitive, ls]	397	420	0.0021
LRR [sensitive, ls]	397	420	0.054
LRR [sensitive, ls]	421	444	0.13
LRR [sensitive, ls]	421	444	3.4
LRR [sensitive, ls]	445	468	0.0057
LRR [sensitive, ls]	445	468	0.15
LRR [sensitive, ls]	469	493	0.0085
LRR [sensitive, ls]	469	493	0.23
LRR [sensitive, ls]	494	517	0.4
LRR [sensitive, ls]	494	517	11
LRR [sensitive, ls]	518	541	0.8
LRR [sensitive, ls]	518	541	21
LRR [sensitive, ls]	542	565	0.096
LRR [sensitive, ls]	542	565	2.5
LRR [sensitive, ls]	566	589	4.7e-05
LRR [sensitive, ls]	566	589	0.0012
LRR [sensitive, ls]	590	623	0.69
LRR [sensitive, ls]	590	623	18

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	4	606	1e-48
Xa21 [O. sativa]	7	822	1e-156
CLV2 [A. thaliana]	22	677	5e-57
FLS2 [A.thaliana]	26	622	4e-83
Cf-9 [L. pimpinellifolium]	79	636	6e-54
FLS2 [A.thaliana]	79	478	4e-41
FLS2 [A.thaliana]	89	1002	1e-124
Pto [L. esculentum]	681	955	3e-24
Rpg1 [Hordeum vulgare]	690	1001	6e-29
Rpg1 [Hordeum vulgare]	702	923	3e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	652	674	out -> in

Report for 4356.m00196

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)