Report for 4371.m00095

 > 4371.m00095, length: 1046, copies: 1 

MAFPSGKAYYLHLLLLAILPSLVARRGAAQQGGVDEKQLLLQVKRAWGDPAALASWTDAAPHCRWVYVSCDGGGT

GRVTSLSLPNVAVAGAVPDAIGGLTALTVLNLQNTSVGGVFPAFLYNLTAITSIDLSMNSIGGELPADIDRLGKN

LTYLALNNNNFTGVIPAAVSKLKNLKVFTLNCNQLTGTIPAALGELTSLETLKLEVNQFTPGELPGSFKNLTSLK

TVWLAQCNLTGDFPSYVTEMMEMEYLDLSQNSFTGSIPPGIWNIPKLQYLFLYTNQLTGDVVVNGKIGAASLIYL

DISENQLTGTIPESFGSLMNLTNLALMTNNFSGEIPASLAQLPSLVIMKLFENNLTGQIPAELGKHSPFLRDIEV

DNNDLTGPIPEGVCDNRRLWIISAAGNRLNGSIPASLATCPALLSLQLQDNELSGEVPAALWTETRLITVLLQNN

GHLTGSLPEKLYWNLTRLYIHNNRFSGRLPATATKLQKFNAENNLFSGEIPDGFAAGMPLLQELDLSRNQLSGAI

PVSIASLSGLSQMNFSRNQFTGDIPAGLGSMPVLTLLDLSSNKLSGGIPTSLGSLKINQLNLSSNQLTGEIPAAL

AISAYDQSFLGNPGLCVSAAPAGNFAGLRSCAAKASDGVSPGLRSGLLAAGAALVVLIGALAFFVVRDIKRRKRL

ARTEPAWKMTPFQPLDFSEASLVRGLADENLIGKGGAGRVYRVAYASRSSGGAGGTVAVKRIWTGGKLDKNLERE

FDSEVDILGHVRHTNIVKLLCCLSRAETKLLVYEYMENGSLDKWLHGNKLLAGGATARAPSVRRAPLDWLARVRV

AVGAARGLCYMHHECSPPIVHRDIKSSNILLDAELMAKVADFGLARMLVQAGTPDTMTAVAGSFGYMAPECAYTR

KVNEKVDVYSFGVVLLELITGREAHDGGEHGSLAEWAWRHLQSGRSIADAVDRCITDSGYGDDAEVVFKLGIICT

GAQPATRPTMRDVLQILVRCEQALQNTVDGKVAEYDGDGAPFLPIRGGSRRKQLSDTKGIDDGNGSLDSIV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	150	173	0.02
LRR [Pfam ls]	174	197	0.16
LRR [Pfam ls]	198	222	0.29
LRR [Pfam ls]	247	270	0.12
LRR [Pfam ls]	296	319	0.018
LRR [Pfam ls]	464	484	4.4
LRR [Pfam ls]	485	509	6.9
LRR [Pfam ls]	510	533	0.088
LRR [Pfam ls]	558	578	4.2
LRR [Pfam ls]	581	601	4.4
Ser/Thr pkinase [Pfam fs]	701	921	6.4e-44
Ser/Thr pkinase [Pfam ls]	701	994	2.6e-38

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	77	100	3.6
LRR [sensitive, ls]	77	100	97
LRR [sensitive, ls]	101	124	0.29
LRR [sensitive, ls]	101	124	7.8
LRR [sensitive, ls]	125	148	1.1
LRR [sensitive, ls]	125	148	29
LRR [sensitive, ls]	150	173	0.00074
LRR [sensitive, ls]	150	173	0.02
LRR [sensitive, ls]	174	197	0.0058
LRR [sensitive, ls]	174	197	0.16
LRR [sensitive, ls]	198	222	0.011
LRR [sensitive, ls]	198	222	0.29
LRR [sensitive, ls]	223	243	1.9
LRR [sensitive, ls]	223	243	52
LRR [sensitive, ls]	247	270	0.0044
LRR [sensitive, ls]	247	270	0.12
LRR [sensitive, ls]	271	291	2.1
LRR [sensitive, ls]	271	291	58
LRR [sensitive, ls]	296	319	0.00068
LRR [sensitive, ls]	296	319	0.018
LRR [sensitive, ls]	320	343	0.56
LRR [sensitive, ls]	320	343	15
LRR [sensitive, ls]	344	368	0.38
LRR [sensitive, ls]	344	368	10
LRR [sensitive, ls]	369	392	0.68
LRR [sensitive, ls]	369	392	19
LRR [sensitive, ls]	393	416	1.3
LRR [sensitive, ls]	393	416	35
LRR [sensitive, ls]	417	440	1.1
LRR [sensitive, ls]	417	440	30
LRR [sensitive, ls]	441	462	2.5
LRR [sensitive, ls]	441	462	67
LRR [sensitive, ls]	464	484	0.16
LRR [sensitive, ls]	464	484	4.4
LRR [sensitive, ls]	485	509	0.26
LRR [sensitive, ls]	485	509	6.9
LRR [sensitive, ls]	510	533	0.0032
LRR [sensitive, ls]	510	533	0.088
LRR [sensitive, ls]	534	557	0.26
LRR [sensitive, ls]	534	557	7.1
LRR [sensitive, ls]	558	578	0.15
LRR [sensitive, ls]	558	578	4.2
LRR [sensitive, ls]	581	601	0.16
LRR [sensitive, ls]	581	601	4.4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	9	796	3e-70
FLS2 [A.thaliana]	49	600	1e-80
CLV2 [A. thaliana]	52	617	4e-50
Cf-9 [L. pimpinellifolium]	55	599	6e-44
FLS2 [A.thaliana]	73	994	1e-112
Cf-9 [L. pimpinellifolium]	77	615	2e-53
CLV2 [A. thaliana]	126	602	1e-45
Cf-9 [L. pimpinellifolium]	275	600	5e-26
Pto [L. esculentum]	691	989	2e-32
Rpg1 [Hordeum vulgare]	696	925	3e-17
Rpg1 [Hordeum vulgare]	702	1004	1e-24

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	647	666	out -> in

Report for 4371.m00095

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)