Report for 4417.m00112

 > 4417.m00112, length: 897, copies: 1 

MAEPRFPPPETLKIALLCLLLPLFSPATASIPSAASTSSDRSCIADERAALLAIKATFFDPNSRLASWQGEDCCS

WWGVRCSNRTGHVIKLRLRGNTDDCLSFYGDKLRGEMSYSLVSLQKLRYLDLSCNNFNWSQIPVFLGSLPSLRYL

NLSYGFFYGSVPPQLGNLSKLAYLDLTSYSYNQLYSVALSWLSHLSSLKHLVMNHVNLTTAVDWVDEINMLPALK

VLYLKQCGLRKTVPFLRRSNITGLEVLDISGNRFHTKIAPNWFWNITSLSALDIRSCGFFGSIPDEIGRMASLEE

VYFQGNNLMSTMIPSSFKNLCNLKVLDLRSTNTTGDIRELIEKLPNCHWNKLQQLGLSYNNIGGTLPNWSEPLAN

LTVLLLSNTNISGAMPSSIWALTKLNILDLCSNKLNGTVREDQLGNLTNLVYLGLGNTHLQIKASSDWIPPFKLQ

LGSEVPPWLRSQTSIQHLQIANTSITTIPDWFWIVFSRADFLDVAYNQITGTLPATLEFMAAKTMDLSNNRFTGM

VPKFPINVTYMYLQRNSLSGPLPSDFGAPLLQSLTLYGNLISGTIPSSLFSLEHLEILDLSGNKLSGEVPTYQED

SNPRTRQLIVVNLNSNNLSGEFPLIFRSCPRLVFLDLSYNQFSGNLPLWMGKKFLPILSLLRLRSNMFSGHIPTE

LTRIDQLQFLDLAENYFSGSIPDSLVNLSAMARTSGYSVLLDEVIATGQGAILNFSWNLINGEIPETIGQLKQLE

SLDLSHNELSGEIPSSMQDLNALGTMNLSYNNLSGRIPRGNTMGSYDASSYIGNIGLCGPPLTRNCSGNATSKDL

PRNHVDLEHISLYLGMAIGFVLSLWVVLCLLLFKTSWRKSYFMFVDRQQKKIYVSVKIRSAVLKRKLGANNH

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	121	145	0.038
LRR [Pfam ls]	146	169	2.8
LRR [Pfam ls]	248	272	0.032
LRR [Pfam ls]	297	321	0.83
LRR [Pfam ls]	351	374	3.7
LRR [Pfam ls]	375	398	0.29
LRR [Pfam ls]	399	423	2.9
LRR [Pfam ls]	464	487	4
LRR [Pfam ls]	555	578	0.38
LRR [Pfam ls]	579	603	4.2
LRR [Pfam ls]	607	630	2.6
LRR [Pfam ls]	631	653	5.1
LRR [Pfam ls]	681	704	0.18
LRR [Pfam ls]	748	771	0.0044

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	121	145	0.0017
LRR [sensitive, ls]	121	145	0.038
LRR [sensitive, ls]	146	169	0.12
LRR [sensitive, ls]	146	169	2.8
LRR [sensitive, ls]	223	245	2.5
LRR [sensitive, ls]	223	245	55
LRR [sensitive, ls]	248	272	0.0014
LRR [sensitive, ls]	248	272	0.032
LRR [sensitive, ls]	273	296	1.4
LRR [sensitive, ls]	273	296	31
LRR [sensitive, ls]	297	321	0.037
LRR [sensitive, ls]	297	321	0.83
LRR [sensitive, ls]	322	345	3.2
LRR [sensitive, ls]	322	345	71
LRR [sensitive, ls]	351	374	0.17
LRR [sensitive, ls]	351	374	3.7
LRR [sensitive, ls]	375	398	0.013
LRR [sensitive, ls]	375	398	0.29
LRR [sensitive, ls]	399	423	0.13
LRR [sensitive, ls]	399	423	2.9
LRR [sensitive, ls]	424	448	0.8
LRR [sensitive, ls]	424	448	18
LRR [sensitive, ls]	464	487	0.18
LRR [sensitive, ls]	464	487	4
LRR [sensitive, ls]	488	508	2.3
LRR [sensitive, ls]	488	508	52
LRR [sensitive, ls]	511	530	1.7
LRR [sensitive, ls]	511	530	39
LRR [sensitive, ls]	532	554	1.3
LRR [sensitive, ls]	532	554	29
LRR [sensitive, ls]	555	578	0.017
LRR [sensitive, ls]	555	578	0.38
LRR [sensitive, ls]	579	603	0.18
LRR [sensitive, ls]	579	603	4.2
LRR [sensitive, ls]	607	630	0.12
LRR [sensitive, ls]	607	630	2.6
LRR [sensitive, ls]	631	653	0.23
LRR [sensitive, ls]	631	653	5.1
LRR [sensitive, ls]	657	677	4.2
LRR [sensitive, ls]	657	677	93
LRR [sensitive, ls]	681	704	0.008
LRR [sensitive, ls]	681	704	0.18
LRR [sensitive, ls]	748	771	0.0002
LRR [sensitive, ls]	748	771	0.0044
LRR [sensitive, ls]	772	792	1.1
LRR [sensitive, ls]	772	792	24

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	12	644	4e-47
Xa21 [O. sativa]	14	623	5e-48
Cf-9 [L. pimpinellifolium]	18	877	6e-64
FLS2 [A.thaliana]	74	864	5e-70
Xa21 [O. sativa]	101	324	7e-12
CLV2 [A. thaliana]	213	891	2e-47
Xa21 [O. sativa]	241	809	4e-52
CLV2 [A. thaliana]	363	788	7e-39
CLV2 [A. thaliana]	492	833	2e-30
Xa21 [O. sativa]	631	788	3e-16

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	836	858	out -> in

Report for 4417.m00112

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)