Report for 4536.m00130

 > 4536.m00130, length: 381, copies: 1 

MGCFGCFSPEVDDDLKPSKPNYHSSDESSGADARRKVAPLATDGGNGYAHSFTFKDLSVATGYFNEANFIGEGGF

GKVYKGKINGQMVAVKQLTRDGVQGRNEFLVEVLMLTVLNHPHLVSLVGFCAQGDERLLVYEYMPFGSLESHLFD

VPLGKQPLDWNTRMRIAVGVAEGLSYLHNVADPPIIYRDMKAANILLDEDYRPKLSDFGLAKVGPVGDRTHVSTR

VMGTYGYCAPDYVVSGKLTMKSDIYSFGVLLLELITGRRIYDASRPKPEQSLLTWSRPFLHDKRKFYRLADPALH

GCYPTSALNQLVVISIMCLQDQPHVRPIISDVVIGLNHVASQPYVPERSSVSLSSPARCGSPQYAGTPSRRRGGR

RVAQYA

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
Ser/Thr pkinase [Pfam fs]	64	262	2.9e-46
Ser/Thr pkinase [Pfam ls]	64	334	5.1e-44

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Rpg1 [Hordeum vulgare]	17	333	9e-28
Pto [L. esculentum]	42	338	4e-54
FLS2 [A.thaliana]	52	336	9e-29
Rpg1 [Hordeum vulgare]	52	339	3e-34

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4536.m00130

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)