Report for 4627.m00063

 > 4627.m00063, length: 1001, copies: 1 

MAAAAATSTLLLLLLLLLLATATHGAAADTVSSPASPEAAALLNLSAALGDPSGYLSTHWTHDTAFCSWPRLSCD

ADGSRVLSLDLSGLNLSGPIPAAALSSLSHLQSLNLSNNILNSTFPEGLIASLKNLRVLDFYNNNLTGALPAALP

NLTNLVHLHLGGNFFFGSIPRSYGQWSRIKYLALSGNELTGEIPPELGNLTTLRELYLGYFNSFTGGIPPELGRL

KELVRLDMANCGISGVVPPEVANLTSLDTLFLQINALSGRLPPEIGAMGALKSLDLSNNLFVGEIPASFASLKNL

TLLNLFRNRLAGEIPEFVGDLPNLEVLQLWENNFTGGVPAQLGVAATRLRIVDVSTNRLTGVLPTELCAGKRLET

FIALGNSLFGSIPDGLAGCPSLTRLRLGENYLNGTIPAKMFTLQNLTQIELHDNLLSGELRLDAGVVSPSIGELS

LYNNRLSGPVPVGIGGLVGLQKLLVAGNRLSGELPREIGKLQQLSKADLSGNLISGEIPPAIAGCRLLTFLDLSG

NRLSGRIPPALAGLRILNYLNLSHNALDGEIPPAIAGMQSLTAVDFSDNNLSGEVPATGQFAYFNATSFAGNPGL

CGAFLSPCRSHGVATTSTFGSLSSASKLLLVLGLLALSIVFAGAAVLKARSLKRSAEARAWRLTAFQRLDFAVDD

VLDCLKEENVIGKGGSGIVYKGAMPGGAVVAVKRLPAMGRSGAAHDDYGFSAEIQTLGRIRHRHIVRLLGFAANR

ETNLLVYEYMPNGSLGEVLHGKKGGHLQWATRYKIAVEAAKGLCYLHHDCSPPILHRDVKSNNILLDAEFEAHVA

DFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVR

MVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSVERPTMREVVQILTDLPGTAAATAMDAPSHGSGK

EQDRSAEMQQQDGSRESPPQQDLLSI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	80	104	6.4
LRR [Pfam ls]	105	129	0.0093
LRR [Pfam fs]	130	153	4.6e-05
LRR [Pfam ls]	130	153	0.00077
LRR [Pfam ls]	178	201	0.0073
LRR [Pfam ls]	227	250	0.9
LRR [Pfam ls]	275	298	0.022
LRR [Pfam ls]	299	322	0.47
LRR [Pfam ls]	323	346	7.7
LRR [Pfam ls]	396	419	7.6
LRR [Pfam ls]	445	468	6.3
LRR [Pfam ls]	469	492	4.7
LRR [Pfam ls]	493	516	4.5
LRR [Pfam ls]	517	540	0.0027
LRR [Pfam ls]	541	564	1.1
Ser/Thr pkinase [Pfam fs]	680	885	1.8e-45
Ser/Thr pkinase [Pfam ls]	680	953	1.1e-40

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	80	104	0.2
LRR [sensitive, ls]	80	104	6.4
LRR [sensitive, ls]	105	129	0.0003
LRR [sensitive, ls]	105	129	0.0093
LRR [sensitive, ls]	130	153	2.5e-05
LRR [sensitive, ls]	130	153	0.00077
LRR [sensitive, ls]	154	177	0.41
LRR [sensitive, ls]	154	177	13
LRR [sensitive, ls]	178	201	0.00023
LRR [sensitive, ls]	178	201	0.0073
LRR [sensitive, ls]	202	226	1.1
LRR [sensitive, ls]	202	226	35
LRR [sensitive, ls]	227	250	0.029
LRR [sensitive, ls]	227	250	0.9
LRR [sensitive, ls]	251	274	0.42
LRR [sensitive, ls]	251	274	13
LRR [sensitive, ls]	275	298	0.00071
LRR [sensitive, ls]	275	298	0.022
LRR [sensitive, ls]	299	322	0.015
LRR [sensitive, ls]	299	322	0.47
LRR [sensitive, ls]	323	346	0.25
LRR [sensitive, ls]	323	346	7.7
LRR [sensitive, ls]	348	372	0.43
LRR [sensitive, ls]	348	372	14
LRR [sensitive, ls]	396	419	0.24
LRR [sensitive, ls]	396	419	7.6
LRR [sensitive, ls]	420	444	0.32
LRR [sensitive, ls]	420	444	10
LRR [sensitive, ls]	445	468	0.2
LRR [sensitive, ls]	445	468	6.3
LRR [sensitive, ls]	469	492	0.15
LRR [sensitive, ls]	469	492	4.7
LRR [sensitive, ls]	493	516	0.14
LRR [sensitive, ls]	493	516	4.5
LRR [sensitive, ls]	517	540	8.6e-05
LRR [sensitive, ls]	517	540	0.0027
LRR [sensitive, ls]	541	564	0.034
LRR [sensitive, ls]	541	564	1.1
LRR [sensitive, ls]	565	587	0.37
LRR [sensitive, ls]	565	587	12

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	10	770	3e-73
FLS2 [A.thaliana]	37	581	2e-74
CLV2 [A. thaliana]	38	581	4e-54
Cf-9 [L. pimpinellifolium]	60	581	9e-50
CLV2 [A. thaliana]	63	538	4e-41
Cf-9 [L. pimpinellifolium]	79	616	5e-55
FLS2 [A.thaliana]	79	961	1e-116
Pto [L. esculentum]	665	951	2e-37
Rpg1 [Hordeum vulgare]	668	952	2e-25
Rpg1 [Hordeum vulgare]	673	957	6e-32

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	27	in -> out

Report for 4627.m00063

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)