Report for 4739.m00119

 > 4739.m00119, length: 998, copies: 1 

MALLCISMVLLILLAPCATSLTPPYNNTDLAALLDFKEQVKDPNGILASNWTASAPFCSWIGVSCDSSGKWVTGL

EFEDMALEGTISPQIGNLSFLSSLVLSNTTLIGPVPTELDRLPRLQTLVLSYNSLSGTIPSILGNLTRLESLYLN

SNKFFGGIPQELANLNNLQILRLSDNDLSGPIPQGLFNNTPNLSRIQLGSNRLTGAIPGSVGSLSKLEMLVLENN

LLSGSMPAAIFNMSYLQAIAVTRNNLRGPIPGNESFHLPMLEFFSLGENWFDGPIPSGPSKCQNLDLFSLAVNNF

TGSVPSWLATMPNLTAIYLSTNELTGKIPVELSNHTGLLALDLSENNLEGEIPPEFGQLRNLSNLNTIGMSYNRF

EGSLLPCVGNLSTLIEIFVADNNRITGSIPSTLAKLTNLLMLSLRGNQLSGMIPTQITSMNNLQELNLSNNTLSG

TIPVEITGLTSLVKLNLANNQLVSPIPSTIGSLNQLQVVVLSQNSLSSTIPISLWHLQKLIELDLSQNSLSGSLP

ADVGKLTAITKMDLSRNQLSGDIPFSFGELQMMIYMNLSSNLLQGSIPDSVGKLLSIEELDLSSNVLSGVIPKSL

ANLTYLANLNLSFNRLEGQIPEGGVFSNITVKSLMGNKALCGLPSQGIESCQSKTHSRKMNKPGKMPLPSDADLL

NYQLISYHELVRATRNFSDDNLLGSGSFGKVFKGQLDDESIVTIKVLNMQQEVASKSFDTECRVLRMAHHRNLVR

IVSTCSNLDFKALVLEYMPNGSLDNWLYSNDGLHLSFIQRLSVMLDVAMAMEYLHHHHFEVVLHFDLKPSNILLD

NDMVAHVADFGISKLLFGDDNSITLTSMPGTVGYMAPELGSTGKASRRSDVYSYGIVLLEVFTRKKPTDPMFVNE

LTFRQWISQAFPYELSNVADCSLQQDGHTGGTEDSSKLSEDSIILNICLASIIELGLLCSRDAPDDRVPMNEVVI

KLNKIKSNYYSLWKQWSSPGEIS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	119	142	0.0091
LRR [Pfam ls]	143	166	0.4
LRR [Pfam ls]	167	191	0.024
LRR [Pfam ls]	192	215	3.3
LRR [Pfam ls]	216	239	3.3
LRR [Pfam ls]	313	336	0.66
LRR [Pfam ls]	337	360	0.025
LRR [Pfam fs]	437	460	4.6e-05
LRR [Pfam ls]	437	460	0.00077
LRR [Pfam ls]	461	484	0.19
LRR [Pfam ls]	485	508	3.5
LRR [Pfam ls]	509	532	0.024
LRR [Pfam ls]	533	556	2.5
LRR [Pfam ls]	581	604	0.0029
LRR [Pfam ls]	605	627	9.3
Ser/Thr pkinase [Pfam fs]	692	894	2.6e-54
Ser/Thr pkinase [Pfam ls]	692	944	6e-49

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	95	118	3.4
LRR [sensitive, ls]	95	118	68
LRR [sensitive, ls]	119	142	0.00046
LRR [sensitive, ls]	119	142	0.0091
LRR [sensitive, ls]	143	166	0.02
LRR [sensitive, ls]	143	166	0.4
LRR [sensitive, ls]	167	191	0.0012
LRR [sensitive, ls]	167	191	0.024
LRR [sensitive, ls]	192	215	0.17
LRR [sensitive, ls]	192	215	3.3
LRR [sensitive, ls]	216	239	0.17
LRR [sensitive, ls]	216	239	3.3
LRR [sensitive, ls]	289	312	1.7
LRR [sensitive, ls]	289	312	34
LRR [sensitive, ls]	313	336	0.033
LRR [sensitive, ls]	313	336	0.66
LRR [sensitive, ls]	337	360	0.0013
LRR [sensitive, ls]	337	360	0.025
LRR [sensitive, ls]	364	387	1.5
LRR [sensitive, ls]	364	387	30
LRR [sensitive, ls]	388	412	0.61
LRR [sensitive, ls]	388	412	12
LRR [sensitive, ls]	413	436	0.59
LRR [sensitive, ls]	413	436	12
LRR [sensitive, ls]	437	460	3.9e-05
LRR [sensitive, ls]	437	460	0.00077
LRR [sensitive, ls]	461	484	0.0095
LRR [sensitive, ls]	461	484	0.19
LRR [sensitive, ls]	485	508	0.18
LRR [sensitive, ls]	485	508	3.5
LRR [sensitive, ls]	509	532	0.0012
LRR [sensitive, ls]	509	532	0.024
LRR [sensitive, ls]	533	556	0.13
LRR [sensitive, ls]	533	556	2.5
LRR [sensitive, ls]	557	580	2.9
LRR [sensitive, ls]	557	580	57
LRR [sensitive, ls]	581	604	0.00015
LRR [sensitive, ls]	581	604	0.0029
LRR [sensitive, ls]	605	627	0.47
LRR [sensitive, ls]	605	627	9.3

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	16	654	1e-66
FLS2 [A.thaliana]	29	653	2e-85
Xa21 [O. sativa]	29	792	1e-131
Cf-9 [L. pimpinellifolium]	50	644	1e-71
FLS2 [A.thaliana]	70	369	3e-19
FLS2 [A.thaliana]	75	377	9e-43
FLS2 [A.thaliana]	82	997	1e-142
Cf-9 [L. pimpinellifolium]	162	653	5e-50
FLS2 [A.thaliana]	270	714	2e-60
Rpg1 [Hordeum vulgare]	658	891	3e-27
Pto [L. esculentum]	684	977	4e-34
Rpg1 [Hordeum vulgare]	689	980	1e-19

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4739.m00119

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)