Report for 4751.m00109

 > 4751.m00109, length: 705, copies: 1 

MVLLLLLLLALPAAAGGLAADGQALLAFKAAVLRDPEGALADWDASTAADPCAWNGVSCGAGSGAGGADRRVVAL

SLPRKGLVGSLPASPLPASLRHLNLRSNRLFGELPAPLLSAAAGLQSVVLYGNELYGPIPPELGDLPYLQILDLS

SNSLNGTLPPAILRCRRLRSLALGWNNLTGALPQGFARGLSALEHLDLSHNRFSGAVPEDIGNLSRLEGTVDLSH

NQFSGQIPASLGRLPEKVYIDLTYNNLSGPIPQNGALENRGPTAFVGNPGLCGPPLKNPCSPDAMPSSNPFVPKD

GGSGAPGAGKNKGLGKVAIVAIVLSDVVGILIIALVFFYCYWRAVSSKEKGNGGAAGSKGSRCGKDCGCFSRDES

ATPSEHTEQYDLVPLDQQVRFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTMAVRRLGEGGLQRFKEFQTEVEA

IGKVRHPSIVTLRAYYWSYDEKLLIYDYIPNGSLSAAIHGKPGTMTFTPLPWDGRLKIMQGVAKGLSFLHEFSPK

KYIHGDLRPNNVLLGSNMEPYISDFGLGRLANIAGGSPFTQSDHAGIEKAQSQQSDASVSPLVGKGSCYQAPEAL

KTLKPSQKWDVYSYGVILLEMITGRSPVVLLETMQMDLVQWVQFCIEEKKPSADVLDPSLARDSEREDEMIAALK

VALACVQANPERRPSMRHVAETLDHLNGSG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	94	118	2.2
LRR [Pfam ls]	119	142	7.4
LRR [Pfam ls]	143	166	1.2
LRR [Pfam ls]	167	191	6.8
LRR [Pfam ls]	192	215	0.0091
Ser/Thr pkinase [Pfam ls]	407	694	3e-23
Ser/Thr pkinase [Pfam fs]	415	627	3e-27

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	94	118	0.11
LRR [sensitive, ls]	94	118	2.2
LRR [sensitive, ls]	119	142	0.38
LRR [sensitive, ls]	119	142	7.4
LRR [sensitive, ls]	143	166	0.062
LRR [sensitive, ls]	143	166	1.2
LRR [sensitive, ls]	167	191	0.35
LRR [sensitive, ls]	167	191	6.8
LRR [sensitive, ls]	192	215	0.00046
LRR [sensitive, ls]	192	215	0.0091
LRR [sensitive, ls]	216	240	6.1
LRR [sensitive, ls]	216	240	120

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	1	257	4e-26
Xa21 [O. sativa]	2	257	9e-31
CLV2 [A. thaliana]	67	257	1e-12
FLS2 [A.thaliana]	67	259	1e-19
Xa21 [O. sativa]	67	259	1e-18
Cf-9 [L. pimpinellifolium]	70	257	8e-14
CLV2 [A. thaliana]	71	257	9e-21
Cf-9 [L. pimpinellifolium]	72	258	2e-16
FLS2 [A.thaliana]	72	259	1e-19
FLS2 [A.thaliana]	72	264	5e-16
Cf-9 [L. pimpinellifolium]	75	285	1e-14
Cf-9 [L. pimpinellifolium]	75	257	1e-14
CLV2 [A. thaliana]	75	259	1e-18
FLS2 [A.thaliana]	75	703	4e-61
FLS2 [A.thaliana]	75	257	8e-17
Xa21 [O. sativa]	75	489	4e-26
Xa21 [O. sativa]	93	264	2e-21
FLS2 [A.thaliana]	94	258	1e-19
CLV2 [A. thaliana]	122	256	2e-13
FLS2 [A.thaliana]	122	273	6e-15
Xa21 [O. sativa]	147	259	4e-13
Pto [L. esculentum]	392	700	2e-30
Rpg1 [Hordeum vulgare]	399	702	4e-15
Rpg1 [Hordeum vulgare]	408	701	8e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	317	339	out -> in

Report for 4751.m00109

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)