Report for 4751.m00111

 > 4751.m00111, length: 972, copies: 1 

MLLLLLFALTLGHGARSAAPLPRRGTSLRAQVAALLHWKSTLKGFSQHQLGTWRHDIHPCNWTGITCGDVPWRQR

RHGRTTARNAITGIALPGAHLVGGLDTLSFRSFPYLASLDLSDNGHLSGTIPPGISSLLMLSSLNLSSNQLTGNI

PPSIGDLGRISSIDLSYNNLTGEIPPALGNLTKLTYLSLLGNKLSGNIPWQLGKLHDISFIDLSLNLLVGPILSL

FGNLTKLTSLFLVGNHLSGPIPDELGEIQTLQYLDLQQNNLNGSITSTLGNLTMLKILYIYLNQHTGTIPQVFGM

LSSLVELDLSENHLTGSIPSSVGNLTSSVYFSLWGNHITGSIPQEIGNLVNLQQLDLSVNFITGPVPSTIGNMSS

LNYILINSNNLSAPIPEEFGNLASLISFASYENQLSGPIPPSLGKLESVSEILLFSNQLSGQLPPALFNLTNLID

IELDKNYLVGPLPDLCRGKKLEILHLSHNNLNGSMPKTLRDCISLRSLGISYNKMDGDITDALGVYPHLWRLTGE

IPPEIGKLVNLNLIDLRNNQLSGKVPNQIGQLKSLEILDFSSNQLSGAIPDDLGNCFKLQSLKMSNNSLNGSIPS

TLGHFLSLQSMLDLSQNNLSGPIPSELGMLEMLMYVNLSHNQFSGAIPGSIASMQSLSVFDVSYNVLEGPIPRPL

HNASAKWFVHNKGLCGELAGLSHCYLPPYHRKTRLKLIVEVSAPVFLAIISIVATVFLLSVCRKKLSQENNNVVK

KNDIFSVWSFDGKMAFDDIISATDNFDEKHCIGEGAYGRVYKAELEDKQVFAVKKLHPDDEDTVHDEERFQIEIE

MLAKIRHRSIVKLYGFCCHPRAYVSDFGIARILKPDSSNWSALAGTYGYIAPELSYTSLVTEKCDVYSFGVVVLE

VLMGKHPGDIQSSITTSKYDDFLDEILDKRLPVPADDEADDVNRCLSVAFDCLLPSPQERPTMCQVYQRLAI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	110	134	0.48
LRR [Pfam ls]	135	158	0.65
LRR [Pfam ls]	159	182	0.0036
LRR [Pfam ls]	183	206	7.1
LRR [Pfam ls]	231	254	6.2
LRR [Pfam ls]	255	278	0.16
LRR [Pfam ls]	303	326	0.0023
LRR [Pfam ls]	351	374	0.1
LRR [Pfam ls]	375	398	7.6
LRR [Pfam ls]	423	446	10
LRR [Pfam ls]	470	493	0.76
LRR [Pfam ls]	535	558	0.39
LRR [Pfam ls]	559	582	0.18
LRR [Pfam ls]	583	606	0.55
Ser/Thr pkinase [Pfam fs]	776	848	2e-16
Ser/Thr pkinase [Pfam ls]	776	972	1.4e-12
Ser/Thr pkinase [Pfam fs]	849	972	7.8e-14

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	110	134	0.024
LRR [sensitive, ls]	110	134	0.48
LRR [sensitive, ls]	135	158	0.033
LRR [sensitive, ls]	135	158	0.65
LRR [sensitive, ls]	159	182	0.00018
LRR [sensitive, ls]	159	182	0.0036
LRR [sensitive, ls]	183	206	0.36
LRR [sensitive, ls]	183	206	7.1
LRR [sensitive, ls]	207	230	1.5
LRR [sensitive, ls]	207	230	29
LRR [sensitive, ls]	231	254	0.31
LRR [sensitive, ls]	231	254	6.2
LRR [sensitive, ls]	255	278	0.008
LRR [sensitive, ls]	255	278	0.16
LRR [sensitive, ls]	303	326	0.00012
LRR [sensitive, ls]	303	326	0.0023
LRR [sensitive, ls]	327	350	2.5
LRR [sensitive, ls]	327	350	50
LRR [sensitive, ls]	351	374	0.0053
LRR [sensitive, ls]	351	374	0.1
LRR [sensitive, ls]	375	398	0.38
LRR [sensitive, ls]	375	398	7.6
LRR [sensitive, ls]	423	446	0.51
LRR [sensitive, ls]	423	446	10
LRR [sensitive, ls]	447	469	8
LRR [sensitive, ls]	447	469	160
LRR [sensitive, ls]	470	493	0.038
LRR [sensitive, ls]	470	493	0.76
LRR [sensitive, ls]	494	517	1.9
LRR [sensitive, ls]	494	517	37
LRR [sensitive, ls]	535	558	0.02
LRR [sensitive, ls]	535	558	0.39
LRR [sensitive, ls]	559	582	0.0092
LRR [sensitive, ls]	559	582	0.18
LRR [sensitive, ls]	583	606	0.028
LRR [sensitive, ls]	583	606	0.55
LRR [sensitive, ls]	632	655	0.93
LRR [sensitive, ls]	632	655	18
LRR [sensitive, ls]	656	679	1
LRR [sensitive, ls]	656	679	20

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	27	675	1e-94
CLV2 [A. thaliana]	33	671	3e-54
Xa21 [O. sativa]	34	842	2e-95
FLS2 [A.thaliana]	93	841	1e-106
Cf-9 [L. pimpinellifolium]	103	673	3e-52
CLV2 [A. thaliana]	111	517	6e-44
Cf-9 [L. pimpinellifolium]	116	396	3e-26
CLV2 [A. thaliana]	124	579	7e-42
CLV2 [A. thaliana]	127	695	2e-55
Cf-9 [L. pimpinellifolium]	131	679	2e-57
FLS2 [A.thaliana]	521	677	6e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	714	736	out -> in

Report for 4751.m00111

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)