Report for 4803.m00053

 > 4803.m00053, length: 995, copies: 1 

MPRFLAILSAIAVVAISGHAPPAASTAATDRAALLSFSSGVHGNLSDWGSPAAAMCNWTGVRCDNRSGRVTGLLL

SNSNLAGVISPAIANLSMLERLYLDGNHLAGGVPPELGALPRLRELSLHYNLLGGQIPEALGRLTSVTYLTLDGN

GLAGGIPEAVFCNCSGLTFIGMSGNSLTGDIPLRPRCRGLPALRQLSLFGNALSGVIPPALSNCTDLRWLLLQDN

SLSGELPPEMFGSMPSLVFLYLSHNHFSSSDGNTNLVPFFSSLVNCTGLLELGVASAGVGGEIPAIIGNVSSANL

SSLFLSGNEFVGKIPPAIGNLVNLTELCLFGNMLEGPIPPEILRPPRLALLDLSNNQIVGEIPRSVGESQRLETI

NLSQNKLQGTLPESLSNLTQLDHLVLHHNMLSGTIPPGLNCSLILDLSYNKLTGQIPSEITVLGNFHVYLNLSNN

LLDGHVPLQIGNMEMTEALDLSMNNLSGAIPATIAGCVALEYINLSGNSLQGSLPTSIGKLPNLHVLDVSSNGLT

GVLPPSLQASPALRYANFSYNKFSGEVSGEGAFANLTDDSFVGNPGLCGSIAGMARCDRRRHVHRRLLCIVAVAV

AVVAGVSAMALTWLKKLTTTSVSPHLSSGGVMDERNSEHPRISHRELVDATGGFSEANLIGKGGYGHVYRGVLHG

GTVVAVKVLRAGDDVVVAGSFERECRVLRSIRHRNLIRVITACSSPEFKAVVLPFMANGSLDGLIHPPPPPPPGG

KPAAKAHRRLDLELLLSIAGNVADGMAYLHHHAPFGVVHCDLKPSNVLLDDDMTAIVSDFGVSKLVAQQEDAKDP

DAIDDDDDDASSTPYPRSSITRLLQGSVGYIAPEYGLGCNPSTQGDVYSFGVLLMEMITGKRPTEVIAEEGHSLH

EWVKRRLSSDDDVVAAVELSAATSPRHETHVVVELLELGVACSRIVPAMRPTMDDVAQEIARLKDGAWRKCCCED

DNDHCIRSDPRDNSVLGEGF

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	93	116	0.29
LRR [Pfam ls]	117	140	0.044
LRR [Pfam ls]	141	165	0.15
LRR [Pfam ls]	192	215	0.15
LRR [Pfam ls]	216	240	0.0094
LRR [Pfam ls]	241	269	0.98
LRR [Pfam ls]	299	322	0.044
LRR [Pfam ls]	347	370	2.3
LRR [Pfam ls]	371	394	0.0027
LRR [Pfam ls]	395	415	0.4
LRR [Pfam ls]	489	512	0.028
LRR [Pfam ls]	513	536	0.055
Ser/Thr pkinase [Pfam fs]	654	890	1.7e-45
Ser/Thr pkinase [Pfam ls]	654	956	7.6e-40

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	69	92	0.5
LRR [sensitive, ls]	69	92	12
LRR [sensitive, ls]	93	116	0.013
LRR [sensitive, ls]	93	116	0.29
LRR [sensitive, ls]	117	140	0.0019
LRR [sensitive, ls]	117	140	0.044
LRR [sensitive, ls]	141	165	0.0066
LRR [sensitive, ls]	141	165	0.15
LRR [sensitive, ls]	166	191	1.4
LRR [sensitive, ls]	166	191	32
LRR [sensitive, ls]	192	215	0.0063
LRR [sensitive, ls]	192	215	0.15
LRR [sensitive, ls]	216	240	0.0004
LRR [sensitive, ls]	216	240	0.0094
LRR [sensitive, ls]	241	269	0.042
LRR [sensitive, ls]	241	269	0.98
LRR [sensitive, ls]	299	322	0.0019
LRR [sensitive, ls]	299	322	0.044
LRR [sensitive, ls]	323	346	0.4
LRR [sensitive, ls]	323	346	9.3
LRR [sensitive, ls]	347	370	0.1
LRR [sensitive, ls]	347	370	2.3
LRR [sensitive, ls]	371	394	0.00012
LRR [sensitive, ls]	371	394	0.0027
LRR [sensitive, ls]	395	415	0.017
LRR [sensitive, ls]	395	415	0.4
LRR [sensitive, ls]	416	439	0.66
LRR [sensitive, ls]	416	439	15
LRR [sensitive, ls]	489	512	0.0012
LRR [sensitive, ls]	489	512	0.028
LRR [sensitive, ls]	513	536	0.0024
LRR [sensitive, ls]	513	536	0.055
LRR [sensitive, ls]	537	562	1.4
LRR [sensitive, ls]	537	562	33

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	1	742	1e-111
CLV2 [A. thaliana]	30	583	4e-55
FLS2 [A.thaliana]	33	555	3e-73
Cf-9 [L. pimpinellifolium]	42	388	2e-14
Cf-9 [L. pimpinellifolium]	52	532	4e-39
Cf-9 [L. pimpinellifolium]	65	574	3e-46
FLS2 [A.thaliana]	72	339	3e-23
FLS2 [A.thaliana]	73	967	1e-122
FLS2 [A.thaliana]	300	558	2e-30
Pto [L. esculentum]	627	956	2e-23
Rpg1 [Hordeum vulgare]	651	963	5e-23
Rpg1 [Hordeum vulgare]	651	963	3e-16

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	478	500	out -> in
putative TM domain	478	500	out -> in
putative TM domain	592	614	in -> out
putative TM domain	592	614	in -> out

Report for 4803.m00053

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)