Report for 4803.m00054

 > 4803.m00054, length: 1060, copies: 1 

MAPVPISVFVFVFIFIFFLLDGSIPTLGSNDHSALMSFKSGVSNDPNGALANWGSLNVCNWTGVSCDASRRRVVK

LMLRDQKLSGEVSPALGNLSHLNILNLSGNLFAGRVPPELGNLFRLTLLDISSNTFVGRVPAELGNLSSLNTLDL

SRNLFTGEVPPELGDLSKLQQLSLGNNLLEGKIPVELTRMSNLSYLNLGENNLSGRIPPAIFCNFSSLQYIDLSS

NSLDGEIPIDCPLPNLMFLVLWANNLVGEIPRSLSNSTNLKWLLLESNYLSGELPADMFGGMRKLELLYLSFNYL

RSPENNTNLEPFFASLTNCTSLKELGVAGNELAGVIPPIAGRLGPGLTQLHLEYNSIFGAIPANLSNLTNLTALN

LSHNLINGSIPPAAVAGMRRLERLYLSDNMLSGEIPPSLGEVPRLGLVDLSRNRLAGGIPAAALSNLTQLRWLVL

HHNHLAGVIPPGIAQCVNLQNLDLSHNMLRGKIPDDLSELSGLLYLNLSSNLLEGMIPATIGRMAMLQVLNLSSN

RLSGDIPTQIGGCVALEYVNVSGNALEGGLPDAVAALPFLQVLDVSYNGLSGALPPSLGAAASLRRVNFSYNGFS

GEVPGDGAFASFPDDAFLGDDGLCGVRPGMARCGGRRGEKRRVLHDRRVLLPIVVTVVGFTLAILGVVACRAAAR

AEVVRRDARRSMLLAGGAGDEPGERDHPRISHRELAEATGGFDQASLIGAGRFGRVYEGTLRDGTRVAVKVLDPK

SGGEVSRSFKRECEVLRRTRHRNLVRVVTTCSQPDFHALVLPLMRNGSLEGRLYPRDGRAGRGLGLAQLVAVAAD

VAEGLAYLHHYAPVRVVHCDLKPSNVLLDDDMTAVVADFGIAKLVKNADGDVTTNSGSIAAASSDPCNSITGLLQ

GSVGYIAPEYGLGGHPSTQGDVYSFGVMILELITGKRPTDVIFHEGLTLHDWVRRHYPHDVAAVVARSWLTDAAV

GYDVVAELINVGLACTQHSPPARPTMVEVCHEMALLKEDLAKHGHGGSGGDVVAAATVMAAAAPPSVAMTASERS

CSTSDSSLSY

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	96	119	0.79
LRR [Pfam ls]	120	143	0.56
LRR [Pfam ls]	144	167	0.025
LRR [Pfam ls]	168	191	0.41
LRR [Pfam ls]	192	216	0.0024
LRR [Pfam ls]	217	239	2.6
LRR [Pfam ls]	264	288	0.023
LRR [Pfam ls]	289	317	0.31
LRR [Pfam ls]	346	369	0.51
LRR [Pfam ls]	370	394	0.0032
LRR [Pfam ls]	395	418	0.013
LRR [Pfam ls]	419	443	0.2
LRR [Pfam ls]	444	467	2
LRR [Pfam fs]	468	491	4.2e-05
LRR [Pfam ls]	468	491	0.0007
LRR [Pfam ls]	492	515	3.6
LRR [Pfam ls]	516	539	0.94
LRR [Pfam ls]	540	563	1.2
LRR [Pfam ls]	564	587	1.8
LRR [Pfam ls]	588	613	4.9
Ser/Thr pkinase [Pfam fs]	717	940	7.7e-48
Ser/Thr pkinase [Pfam ls]	717	1009	6.7e-45

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	72	95	1.3
LRR [sensitive, ls]	72	95	29
LRR [sensitive, ls]	96	119	0.034
LRR [sensitive, ls]	96	119	0.79
LRR [sensitive, ls]	120	143	0.024
LRR [sensitive, ls]	120	143	0.56
LRR [sensitive, ls]	144	167	0.0011
LRR [sensitive, ls]	144	167	0.025
LRR [sensitive, ls]	168	191	0.018
LRR [sensitive, ls]	168	191	0.41
LRR [sensitive, ls]	192	216	0.0001
LRR [sensitive, ls]	192	216	0.0024
LRR [sensitive, ls]	217	239	0.11
LRR [sensitive, ls]	217	239	2.6
LRR [sensitive, ls]	240	263	1.4
LRR [sensitive, ls]	240	263	32
LRR [sensitive, ls]	264	288	0.00099
LRR [sensitive, ls]	264	288	0.023
LRR [sensitive, ls]	289	317	0.013
LRR [sensitive, ls]	289	317	0.31
LRR [sensitive, ls]	321	344	1.3
LRR [sensitive, ls]	321	344	30
LRR [sensitive, ls]	346	369	0.022
LRR [sensitive, ls]	346	369	0.51
LRR [sensitive, ls]	370	394	0.00014
LRR [sensitive, ls]	370	394	0.0032
LRR [sensitive, ls]	395	418	0.00056
LRR [sensitive, ls]	395	418	0.013
LRR [sensitive, ls]	419	443	0.0086
LRR [sensitive, ls]	419	443	0.2
LRR [sensitive, ls]	444	467	0.088
LRR [sensitive, ls]	444	467	2
LRR [sensitive, ls]	468	491	3e-05
LRR [sensitive, ls]	468	491	0.0007
LRR [sensitive, ls]	492	515	0.16
LRR [sensitive, ls]	492	515	3.6
LRR [sensitive, ls]	516	539	0.04
LRR [sensitive, ls]	516	539	0.94
LRR [sensitive, ls]	540	563	0.051
LRR [sensitive, ls]	540	563	1.2
LRR [sensitive, ls]	564	587	0.079
LRR [sensitive, ls]	564	587	1.8
LRR [sensitive, ls]	588	613	0.21
LRR [sensitive, ls]	588	613	4.9

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	1	821	1e-125
Cf-9 [L. pimpinellifolium]	8	604	4e-59
CLV2 [A. thaliana]	10	683	2e-71
FLS2 [A.thaliana]	34	629	2e-90
Cf-9 [L. pimpinellifolium]	69	635	5e-48
FLS2 [A.thaliana]	76	1012	1e-124
FLS2 [A.thaliana]	83	606	1e-81
Rpg1 [Hordeum vulgare]	677	1009	2e-24
Pto [L. esculentum]	704	1004	1e-26
Rpg1 [Hordeum vulgare]	710	1008	4e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	7	29	in -> out
putative TM domain	649	671	out -> in
putative TM domain	649	671	out -> in

Report for 4803.m00054

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)